1136- Desmoplakin- GFP

$193.00

  • Model: PVT10351
  • 50 Units in Stock
Ask a question


Add to Cart:

1136- Desmoplakin-GFP


Catalog No. PVT10351
Packing 2ug
Function ORF expression plasmid
Resistance Kan
Screen Neo/G418
Strain DH5alpha
Culture temperature 37degrees centigrade,Aerobic, LB 

Promoter: CMV promoter
Terminator: SV40 poly (A) signal
Plasmid Size: 13661bp
plasmid Label: C-EGFP


1136- Desmoplakin-GFP Description

1136-DESMOPLAKIN-GFP plasmid is a mammalian cell over expression plasmid, CMV promoter Drive Desmoplakin human gene and EGFP green fluorescent protein fusion expression.

 

1136- Desmoplakin-GFP Reference

Desmoplakin assembly dynamics in four dimensions: multiple phases differentially regulated by intermediate filaments and actin.

 

 

1136- Desmoplakin-GFP Sequence

LOCUS       Exported               13661 bp ds-DNA     circular SYN 25-OCT-2017
DEFINITION  synthetic circular DNA
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 13661)
  AUTHORS   .
  TITLE     Direct Submission
             
FEATURES             Location/Qualifiers
     source          1..13661
                     /organism="synthetic DNA construct"
                     /mol_type="other DNA"
     enhancer        68..371
                     /label=CMV enhancer
                     /note="human cytomegalovirus immediate early enhancer"
     promoter        372..575
                     /label=CMV promoter
                     /note="human cytomegalovirus (CMV) immediate early 
                     promoter"
     misc_feature    704..982
                     /label=DP insert 5'region
     misc_feature    983..9600
                     /label=Desmoplakin
     CDS             9614..10333
                     /codon_start=1
                     /product="enhanced GFP"
                     /label=EGFP
                     /note="mammalian codon-optimized"
                     /translation="MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTL
                     KFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDD
                     GNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIK
                     VNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLL
                     EFVTAAGITLGMDELYK"
     polyA_signal    10456..10577
                     /label=SV40 poly(A) signal
                     /note="SV40 polyadenylation signal"
     rep_origin      complement(10584..11039)
                     /direction=LEFT
                     /label=f1 ori
                     /note="f1 bacteriophage origin of replication; arrow 
                     indicates direction of (+) strand synthesis"
     promoter        11066..11170
                     /gene="bla"
                     /label=AmpR promoter
     promoter        11172..11529
                     /label=SV40 promoter
                     /note="SV40 enhancer and early promoter"
     rep_origin      11380..11515
                     /label=SV40 ori
                     /note="SV40 origin of replication"
     CDS             11564..12358
                     /codon_start=1
                     /gene="aph(3')-II (or nptII)"
                     /product="aminoglycoside phosphotransferase from Tn5"
                     /label=NeoR/KanR
                     /note="confers resistance to neomycin, kanamycin, and G418 
                     (Geneticin(R))"
                     /translation="MIEQDGLHAGSPAAWVERLFGYDWAQQTIGCSDAAVFRLSAQGRP
                     VLFVKTDLSGALNELQDEAARLSWLATTGVPCAAVLDVVTEAGRDWLLLGEVPGQDLLS
                     SHLAPAEKVSIMADAMRRLHTLDPATCPFDHQAKHRIERARTRMEAGLVDQDDLDEEHQ
                     GLAPAELFARLKASMPDGEDLVVTHGDACLPNIMVENGRFSGFIDCGRLGVADRYQDIA
                     LATRDIAEELGGEWADRFLVLYGIAAPDSQRIAFYRLLDEFF"
     polyA_signal    12590..12637
                     /label=HSV TK poly(A) signal
                     /note="herpes simplex virus thymidine kinase 
                     polyadenylation signal (Cole and Stacy, 1985)"
     rep_origin      12966..13554
                     /direction=RIGHT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
ORIGIN
        1 catgcattag ttattaatag taatcaatta cggggtcatt agttcatagc ccatatatgg
       61 agttccgcgt tacataactt acggtaaatg gcccgcctgg ctgaccgccc aacgaccccc
      121 gcccattgac gtcaataatg acgtatgttc ccatagtaac gccaataggg actttccatt
      181 gacgtcaatg ggtggagtat ttacggtaaa ctgcccactt ggcagtacat caagtgtatc
      241 atatgccaag tacgccccct attgacgtca atgacggtaa atggcccgcc tggcattatg
      301 cccagtacat gaccttatgg gactttccta cttggcagta catctacgta ttagtcatcg
      361 ctattaccat ggtgatgcgg ttttggcagt acatcaatgg gcgtggatag cggtttgact
      421 cacggggatt tccaagtctc caccccattg acgtcaatgg gagtttgttt tggcaccaaa
      481 atcaacggga ctttccaaaa tgtcgtaaca actccgcccc attgacgcaa atgggcggta
      541 ggcgtgtacg gtgggaggtc tatataagca gagctggttt agtgaaccgt cagatccgct
      601 agcgctaccg gactcagatc tcgagctcaa gcttcgaatt cgcggccgcg tcaacagccc
      661 ctgctccttg ggcccctcca tgccatgccg taatctctcc cacccgacca acaccaacac
      721 ccagctccga cgcagctcct ctgcgccctt gccgccctcc gagccacagc tttcctcccg
      781 ctcctgcccc cggcccgtcg ccgtctccgc gctcgcagcg gcctcgggag ggcccaggta
      841 gcgagcagcg acctcgcgag ccttccgcac tcccgcccgg ttccccggcc gtccgcctat
      901 ccttggcccc ctccgctttc tccgcgccgg cccgcctcgc ttatgcctcg gcgctgagcc
      961 gctctcccga ttgcccgccg acatgagctg caacggaggc tcccacccgc ggatcaacac
     1021 tctgggccgc atgatccgcg ccgagtctgg cccggacctg cgctacgagg tgaccagcgg
     1081 cggcgggggc accagcagga tgtactattc tcggcgcggc gtgatcaccg accagaactc
     1141 ggacggctac tgtcaaaccg gcacgatgtc caggcaccag aaccagaaca ccatccagga
     1201 gctgctgcag aactgctccg actgcttgat gcgagcagag ctcatcgtgc agcctgaatt
     1261 gaagtatgga gatggaatac aactgactcg gagtcgagaa ttggatgagt gttttgccca
     1321 ggccaatgac caaatggaaa tcctcgacag cttgatcaga gagatgcggc agatgggcca
     1381 gccctgtgat gcttaccaga aaaggcttct tcagctccaa gagcaaatgc gagcccttta
     1441 taaagccatc agtgtccctc gagtccgcag ggccagctcc aagggtggtg gaggctacac
     1501 ttgtcagagt ggctctggct gggatgagtt caccaaacat gtcaccagtg aatgtttggg
     1561 gtggatgagg cagcaaaggg cggagatgga catggtggcc tggggtgtgg acctggcctc
     1621 agtggagcag cacattaaca gccaccgggg catccacaac tccatcggcg actatcgctg
     1681 gcagctggac aaaatcaaag ccgacctgcg cgagaaatct gcgatctacc agttggagga
     1741 ggagtatgaa aacctgctga aagcgtcctt tgagaggatg gatcacctgc gacagctgca
     1801 gaacatcatt caggccacgt ccagggagat catgtggatc aatgactgcg aggaggagga
     1861 gctgctgtac gactggagcg acaagaacac caacatcgct cagaaacagg aggccttctc
     1921 catacgcatg agtcaactgg aagttaaaga aaaagagctc aataagctga aacaagaaag
     1981 tgaccaactt gtcctcaatc agcatccagc ttcagacaaa attgaggcct atatggacac
No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart