1136- Desmoplakin- GFP

$193.00

  • Model: PVT10351
  • 50 Units in Stock
Ask a question


Add to Cart:

1136- Desmoplakin-GFP


Catalog No. PVT10351
Packing 2ug
Function ORF expression plasmid
Resistance Kan
Screen Neo/G418
Strain DH5alpha
Culture temperature 37degrees centigrade,Aerobic, LB 

Promoter: CMV promoter
Terminator: SV40 poly (A) signal
Plasmid Size: 13661bp
plasmid Label: C-EGFP


1136- Desmoplakin-GFP Description

1136-DESMOPLAKIN-GFP plasmid is a mammalian cell over expression plasmid, CMV promoter Drive Desmoplakin human gene and EGFP green fluorescent protein fusion expression.

 

1136- Desmoplakin-GFP Reference

Desmoplakin assembly dynamics in four dimensions: multiple phases differentially regulated by intermediate filaments and actin.

 

 

1136- Desmoplakin-GFP Sequence

LOCUS       Exported               13661 bp ds-DNA     circular SYN 25-OCT-2017
DEFINITION  synthetic circular DNA
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 13661)
  AUTHORS   .
  TITLE     Direct Submission
             
FEATURES             Location/Qualifiers
     source          1..13661
                     /organism="synthetic DNA construct"
                     /mol_type="other DNA"
     enhancer        68..371
                     /label=CMV enhancer
                     /note="human cytomegalovirus immediate early enhancer"
     promoter        372..575
                     /label=CMV promoter
                     /note="human cytomegalovirus (CMV) immediate early 
                     promoter"
     misc_feature    704..982
                     /label=DP insert 5'region
     misc_feature    983..9600
                     /label=Desmoplakin
     CDS             9614..10333
                     /codon_start=1
                     /product="enhanced GFP"
                     /label=EGFP
                     /note="mammalian codon-optimized"
                     /translation="MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTL
                     KFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDD
                     GNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIK
                     VNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLL
                     EFVTAAGITLGMDELYK"
     polyA_signal    10456..10577
                     /label=SV40 poly(A) signal
                     /note="SV40 polyadenylation signal"
     rep_origin      complement(10584..11039)
                     /direction=LEFT
                     /label=f1 ori
                     /note="f1 bacteriophage origin of replication; arrow 
                     indicates direction of (+) strand synthesis"
     promoter        11066..11170
                     /gene="bla"
                     /label=AmpR promoter
     promoter        11172..11529
                     /label=SV40 promoter
                     /note="SV40 enhancer and early promoter"
     rep_origin      11380..11515
                     /label=SV40 ori
                     /note="SV40 origin of replication"
     CDS             11564..12358
                     /codon_start=1
                     /gene="aph(3')-II (or nptII)"
                     /product="aminoglycoside phosphotransferase from Tn5"
                     /label=NeoR/KanR
                     /note="confers resistance to neomycin, kanamycin, and G418 
                     (Geneticin(R))"
                     /translation="MIEQDGLHAGSPAAWVERLFGYDWAQQTIGCSDAAVFRLSAQGRP
                     VLFVKTDLSGALNELQDEAARLSWLATTGVPCAAVLDVVTEAGRDWLLLGEVPGQDLLS
                     SHLAPAEKVSIMADAMRRLHTLDPATCPFDHQAKHRIERARTRMEAGLVDQDDLDEEHQ
                     GLAPAELFARLKASMPDGEDLVVTHGDACLPNIMVENGRFSGFIDCGRLGVADRYQDIA
                     LATRDIAEELGGEWADRFLVLYGIAAPDSQRIAFYRLLDEFF"
     polyA_signal    12590..12637
                     /label=HSV TK poly(A) signal
                     /note="herpes simplex virus thymidine kinase 
                     polyadenylation signal (Cole and Stacy, 1985)"
     rep_origin      12966..13554
                     /direction=RIGHT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
ORIGIN
        1 catgcattag ttattaatag taatcaatta cggggtcatt agttcatagc ccatatatgg
       61 agttccgcgt tacataactt acggtaaatg gcccgcctgg ctgaccgccc aacgaccccc
      121 gcccattgac gtcaataatg acgtatgttc ccatagtaac gccaataggg actttccatt
      181 gacgtcaatg ggtggagtat ttacggtaaa ctgcccactt ggcagtacat caagtgtatc
      241 atatgccaag tacgccccct attgacgtca atgacggtaa atggcccgcc tggcattatg
      301 cccagtacat gaccttatgg gactttccta cttggcagta catctacgta ttagtcatcg
      361 ctattaccat ggtgatgcgg ttttggcagt acatcaatgg gcgtggatag cggtttgact
      421 cacggggatt tccaagtctc caccccattg acgtcaatgg gagtttgttt tggcaccaaa
      481 atcaacggga ctttccaaaa tgtcgtaaca actccgcccc attgacgcaa atgggcggta
      541 ggcgtgtacg gtgggaggtc tatataagca gagctggttt agtgaaccgt cagatccgct
      601 agcgctaccg gactcagatc tcgagctcaa gcttcgaatt cgcggccgcg tcaacagccc
      661 ctgctccttg ggcccctcca tgccatgccg taatctctcc cacccgacca acaccaacac
      721 ccagctccga cgcagctcct ctgcgccctt gccgccctcc gagccacagc tttcctcccg
      781 ctcctgcccc cggcccgtcg ccgtctccgc gctcgcagcg gcctcgggag ggcccaggta
      841 gcgagcagcg acctcgcgag ccttccgcac tcccgcccgg ttccccggcc gtccgcctat
      901 ccttggcccc ctccgctttc tccgcgccgg cccgcctcgc ttatgcctcg gcgctgagcc
      961 gctctcccga ttgcccgccg acatgagctg caacggaggc tcccacccgc ggatcaacac
     1021 tctgggccgc atgatccgcg ccgagtctgg cccggacctg cgctacgagg tgaccagcgg
     1081 cggcgggggc accagcagga tgtactattc tcggcgcggc gtgatcaccg accagaactc
     1141 ggacggctac tgtcaaaccg gcacgatgtc caggcaccag aaccagaaca ccatccagga
     1201 gctgctgcag aactgctccg actgcttgat gcgagcagag ctcatcgtgc agcctgaatt
     1261 gaagtatgga gatggaatac aactgactcg gagtcgagaa ttggatgagt gttttgccca
     1321 ggccaatgac caaatggaaa tcctcgacag cttgatcaga gagatgcggc agatgggcca
     1381 gccctgtgat gcttaccaga aaaggcttct tcagctccaa gagcaaatgc gagcccttta
     1441 taaagccatc agtgtccctc gagtccgcag ggccagctcc aagggtggtg gaggctacac
     1501 ttgtcagagt ggctctggct gggatgagtt caccaaacat gtcaccagtg aatgtttggg
     1561 gtggatgagg cagcaaaggg cggagatgga catggtggcc tggggtgtgg acctggcctc
     1621 agtggagcag cacattaaca gccaccgggg catccacaac tccatcggcg actatcgctg
     1681 gcagctggac aaaatcaaag ccgacctgcg cgagaaatct gcgatctacc agttggagga
     1741 ggagtatgaa aacctgctga aagcgtcctt tgagaggatg gatcacctgc gacagctgca
     1801 gaacatcatt caggccacgt ccagggagat catgtggatc aatgactgcg aggaggagga
     1861 gctgctgtac gactggagcg acaagaacac caacatcgct cagaaacagg aggccttctc
     1921 catacgcatg agtcaactgg aagttaaaga aaaagagctc aataagctga aacaagaaag
     1981 tgaccaactt gtcctcaatc agcatccagc ttcagacaaa attgaggcct atatggacac
     2041 tctgcagacg cagtggagtt ggattcttca gatcaccaag tgcattgatg ttcatctgaa
     2101 agaaaatgct gcctactttc agttttttga agaggcgcag tctactgaag catacctgaa
     2161 ggggctccag gactccatca ggaagaagta cccctgcgac aagaacatgc ccctgcagca
     2221 cctgctggaa cagatcaagg agctggagaa agaacgagag aaaatccttg aatacaagcg
     2281 tcaggtgcag aacttggtaa acaagtctaa gaagattgta cagctgaagc ctcgtaaccc
     2341 agactacaga agcaataaac ccattattct cagagctctc tgtgactaca aacaagatca
     2401 gaaaatcgtg cataaggggg atgagtgtat cctgaaggac aacaacgagc gcagcaagtg
     2461 gtacgtgacg ggcccgggag gcgttgacat gcttgttccc tctgtggggc tgatcatccc
     2521 tcctccgaac ccactggccg tggacctctc ttgcaagatt gagcagtact acgaagccat
     2581 cttggctctg tggaaccagc tctacatcaa catgaagagc ctggtgtcct ggcactactg
     2641 catgattgac atagagaaga tcagggccat gacaatcgcc aagctgaaaa caatgcggca
     2701 ggaagattac atgaagacga tagccgacct tgagttacat taccaagagt tcatcagaaa
     2761 tagccaaggc tcagagatgt ttggagatga tgacaagcgg aaaatacagt ctcagttcac
     2821 cgatgcccag aagcattacc agaccctggt cattcagctc cctggctatc cccagcacca
     2881 gacagtgacc acaactgaaa tcactcatca tggaacctgc caagatgtca accataataa
     2941 agtaattgaa accaacagag aaaatgacaa gcaagaaaca tggatgctga tggagctgca
     3001 gaagattcgc aggcagatag agcactgcga gggcaggatg actctcaaaa acctccctct
     3061 agcagaccag gggtcttctc accacatcac agtgaaaatt aacgagctta agagtgtgca
     3121 gaatgattca caagcaattg ctgaggttct caaccagctt aaagatatgc ttgccaactt
     3181 cagaggttct gaaaagtact gctatttaca gaatgaagta tttggactat ttcagaaact
     3241 ggaaaatatc aatggtgtta cagatggcta cttaaatagc ttatgcacag taagggcact
     3301 gctccaggct attctccaaa cagaagacat gttaaaggtt tatgaagcca ggctcactga
     3361 ggaggaaact gtctgcctgg acctggataa agtggaagct taccgctgtg gactgaagaa
     3421 aataaaaaat gacttgaact tgaagaagtc gttgttggcc actatgaaga cagaactaca
     3481 gaaagcccag cagatccact ctcagacttc acagcagtat ccactttatg atctggactt
     3541 gggcaagttc ggtgaaaaag tcacacagct gacagaccgc tggcaaagga tagataaaca
     3601 gatcgacttt agattatggg acctggagaa acaaatcaag caattgagga attatcgtga
     3661 taactatcag gctttctgca agtggctcta tgatgctaaa cgccgccagg attccttaga
     3721 atccatgaaa tttggagatt ccaacacagt catgcggttt ttgaatgagc agaagaactt
     3781 gcacagtgaa atatctggca aacgagacaa atcagaggaa gtacaaaaaa ttgctgaact
     3841 ttgcgccaat tcaattaagg attatgagct ccagctggcc tcatacacct caggactgga
     3901 aactctgctg aacataccta tcaagaggac catgattcag tccccttctg gggtgattct
     3961 gcaagaggct gcagatgttc atgctcggta cattgaacta cttacaagat ctggagacta
     4021 ttacaggttc ttaagtgaga tgctgaagag tttggaagat ctgaagctga aaaataccaa
     4081 gatcgaagtt ttggaagagg agctcagact ggcccgagat gccaactcgg aaaactgtaa
     4141 taagaacaaa ttcctggatc agaacctgca gaaataccag gcagagtgtt cccagttcaa
     4201 agcgaagctt gcgagcctgg aggagctgaa gagacaggct gagctggatg ggaagtcggc
     4261 taagcaaaat ctagacaagt gctacggcca aataaaagaa ctcaatgaga agatcacccg
     4321 actgacttat gagattgaag atgaaaagag aagaagaaaa tctgtggaag acagatttga
     4381 ccaacagaag aatgactatg accaactgca gaaagcaagg caatgtgaaa aggagaacct
     4441 tggttggcag aaattagagt ctgagaaagc catcaaggag aaggagtacg agattgaaag
     4501 gttgagggtt ctactgcagg aagaaggcac ccggaagaga gaatatgaaa atgagctggc
     4561 aaaggtaaga aaccactata atgaggagat gagtaattta aggaacaagt atgaaacaga
     4621 gattaacatt acgaagacca ccatcaagga gatatccatg caaaaagagg atgattccaa
     4681 aaatcttaga aaccagcttg atagactttc aagggaaaat cgagatctga aggatgaaat
     4741 tgtcaggctc aatgacagca tcttgcaggc cactgagcag cgaaggcgag ctgaagaaaa
     4801 cgcccttcag caaaaggcct gtggctctga gataatgcag aagaagcagc atctggagat
     4861 agaactgaag caggtcatgc agcagcgctc tgaggacaat gcccggcaca agcagtccct
     4921 ggaggaggct gccaagacca ttcaggacaa aaataaggag atcgagagac tcaaagctga
     4981 gtttcaggag gaggccaagc gccgctggga atatgaaaat gaactgagta aggtaagaaa
     5041 caattatgat gaggagatca ttagcttaaa aaatcagttt gagaccgaga tcaacatcac
     5101 caagaccacc atccaccagc tcaccatgca gaaggaagag gataccagtg gctaccgggc
     5161 tcagatagac aatctcaccc gagaaaacag gagcttatct gaagaaataa agaggctgaa
     5221 gaacactcta acccagacca cagagaatct caggagggtg gaagaagaca tccaacagca
     5281 aaaggccact ggctctgagg tgtctcagag gaaacagcag ctggaggttg agctgagaca
     5341 agtcactcag atgcgaacag aggagagcgt aagatataag caatctcttg atgatgctgc
     5401 caaaaccatc caggataaaa acaaggagat agaaaggtta aaacaactga tcgacaaaga
     5461 aacaaatgac cggaaatgcc tggaagatga aaacgcgaga ttacaaaggg tccagtatga
     5521 cctgcagaaa gcaaacagta gtgcgacgga gacaataaac aaactgaagg ttcaggagca
     5581 agaactgaca cgcctgagga tcgactatga aagggtttcc caggagagga ctgtgaagga
     5641 ccaggatatc acgcggttcc agaactctct gaaagagctg cagctgcaga agcagaaggt
     5701 ggaagaggag ctgaatcggc tgaagaggac cgcgtcagaa gactcctgca agaggaagaa
     5761 gctggaggaa gagctggaag gcatgaggag gtcgctgaag gagcaagcca tcaaaatcac
     5821 caacctgacc cagcagctgg agcaggcatc cattgttaag aagaggagtg aggatgacct
     5881 ccggcagcag agggacgtgc tggatggcca cctgagggaa aagcagagga cccaggaaga
     5941 gctgaggagg ctctcttctg aggtcgaggc cctgaggcgg cagttactcc aggaacagga
     6001 aagtgtcaaa caagctcact tgaggaatga gcatttccag aaggcgatag aagataaaag
     6061 cagaagctta aatgaaagca aaatagaaat tgagaggctg cagtctctca cagagaacct
     6121 gaccaaggag cacttgatgt tagaagaaga actgcggaac ctgaggctgg agtacgatga
     6181 cctgaggaga ggacgaagcg aagcggacag tgataaaaat gcaaccatct tggaactaag
     6241 gagccagctg cagatcagca acaaccggac cctggaactg caggggctga ttaatgattt
     6301 acagagagag agggaaaatt tgagacagga aattgagaaa ttccaaaagc aggctttaga
     6361 ggcatctaat aggattcagg aatcaaagaa tcagtgtact caggtggtac aggaaagaga
     6421 gagccttctg gtgaaaatca aagtcctgga gcaagacaag gcaaggctgc agaggctgga
     6481 ggatgagctg aatcgtgcaa aatcaactct agaggcagaa accagggtga aacagcgcct
     6541 ggagtgtgag aaacagcaaa ttcagaatga cctgaatcag tggaagactc aatattcccg
     6601 caaggaggag gctattagga agatagaatc ggaaagagaa aagagtgaga gagagaagaa
     6661 cagtcttagg agtgagatcg aaagactcca agcagagatc aagagaattg aagagaggtg
     6721 caggcgtaag ctggaggatt ctaccaggga gacacagtca cagttagaaa cagaacgctc
     6781 ccgatatcag agggagattg ataaactcag acagcgccca tatgggtccc atcgagagac
     6841 ccagactgag tgtgagtgga ccgttgacac ctccaagctg gtgtttgatg ggctgaggaa
     6901 gaaggtgaca gcaatgcagc tctatgagtg tcagctgatc gacaaaacaa ccttggacaa
     6961 actattgaag gggaagaagt cagtggaaga agttgcttct gaaatccagc cattccttcg
     7021 gggtgcagga tctatcgctg gagcatctgc ttctcctaag gaaaaatact ctttggtaga
     7081 ggccaagaga aagaaattaa tcagcccaga atccacagtc atgcttctgg aggcccaggc
     7141 agctacaggt ggtataattg atccccatcg gaatgagaag ctgactgtcg acagtgccat
     7201 agctcgggac ctcattgact tcgatgaccg tcagcagata tatgcagcag aaaaagctat
     7261 cactggtttt gatgatccat tttcaggcaa gacagtatct gtttcagaag ccatcaagaa
     7321 aaatttgatt gatagagaaa ccggaatgcg cctgctggaa gcccagattg cttcaggggg
     7381 tgtagtagac cctgtgaaca gtgtcttttt gccaaaagat gtcgccttgg cccgggggct
     7441 gattgataga gatttgtatc gatccctgaa tgatccccga gatagtcaga aaaactttgt
     7501 ggatccagtc accaaaaaga aggtcagtta cgtgcagctg aaggaacggt gcagaatcga
     7561 accacatact ggtctgctct tgctttcagt acagaagaga agcatgtcct tccaaggaat
     7621 cagacaacct gtgaccgtca ctgagctagt agattctggt atattgagac cgtccactgt
     7681 caatgaactg gaatctggtc agatttctta tgacgaggtt ggtgagagaa ttaaggactt
     7741 cctccagggt tcaagctgca tagcaggcat atacaatgag accacaaaac agaagcttgg
     7801 catttatgag gccatgaaaa ttggcttagt ccgacctggt actgctctgg agttgctgga
     7861 agcccaagca gctactggct ttatagtgga tcctgttagc aacttgaggt taccagtgga
     7921 ggaagcctac aagagaggtc tggtgggcat tgagttcaaa gagaagctcc tgtctgcaga
     7981 acgagctgtc actgggtata atgatcctga aacaggaaac atcatctctt tgttccaagc
     8041 catgaataag gaactcatcg aaaagggcca cggtattcgc ttattagaag cacagatcgc
     8101 aaccgggggg atcattgacc caaaggagag ccatcgttta ccagttgaca tagcatataa
     8161 gaggggctat ttcaatgagg aactcagtga gattctctca gatccaagtg atgataccaa
     8221 aggatttttt gaccccaaca ctgaagaaaa tcttacctat ctgcaactaa aagaaagatg
     8281 cattaaggat gaggaaacag ggctctgtct tctgcctctg aaagaaaaga agaaacaggt
     8341 gcagacatca caaaagaata ccctcaggaa gcgtagagtg gtcatagttg acccagaaac
     8401 caataaagaa atgtctgttc aggaggccta caagaagggc ctaattgatt atgaaacctt
     8461 caaagaactg tgtgagcagg aatgtgaatg ggaagaaata accatcacgg gatcagatgg
     8521 ctccaccagg gtggtcctgg tagatagaaa gacaggcagt cagtatgata ttcaagatgc
     8581 tattgacaag ggccttgttg acaggaagtt ctttgatcag taccgatccg gcagcctcag
     8641 cctcactcaa tttgctgaca tgatctcctt gaaaaatggt gtcggcacca gcagcagcat
     8701 gggcagtggt gtcagcgatg atgtttttag cagctcccga catgaatcag taagtaagat
No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart