HBV 1.3- mer WT replicon

$193.00

  • Model: PVT10528
  • 50 Units in Stock
Ask a question


Add to Cart:

HBV 1.3-mer WT replicon

Catalog No. PVT10528
Packing 2ug

 

HBV 1.3-mer WT replicon Information


Function Other source plasmids

Replicon: ori

Plasmid classification: gene library plasmid; other gene plasmids; other source plasmids.

Plasmid size: 6821bp

Prokaryotic resistance: ampicillin Amp (100 u g/ml)

Cloned strains of Escherichia coli, DH5 A and other Escherichia coli

Culture conditions: 37 centigrade, aerobic, LB

 

HBV 1.3-mer WT replicon Reference

DDX3 DEAD-Box RNA helicase inhibits hepatitis B virus reverse transcription by incorporation into nucleocapsids.

 

HBV 1.3-mer WT replicon Sequence

LOCUS       Exported                6821 bp ds-DNA     circular SYN 15-AUG-2017

DEFINITION  synthetic circular DNA

 

FEATURES             Location/Qualifiers

     source          1..6821

                     /organism="synthetic DNA construct"

                     /mol_type="other DNA"

     CDS             843..1688

                     /codon_start=1

                     /product="middle (pre-S2/S) envelope protein of hepatitis B

                     virus"

                     /label=HBsAg (pre-S2/S)

                     /note="hepatitis B surface antigen"

                     /translation="MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVLTTASPLSSI

                     FSRIGDPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCL

                     GQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCP

                     LIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGKFLWEWAS

                     ARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI

                     "

     promoter        complement(2866..2884)

                     /label=T7 promoter

                     /note="promoter for bacteriophage T7 RNA polymerase"

     primer_bind     complement(2903..2919)

                     /label=M13 rev

                     /note="common sequencing primer, one of multiple similar 

                     variants"

     protein_bind    2927..2943

                     /label=lac operator

                     /bound_moiety="lac repressor encoded by lacI"

                     /note="The lac repressor binds to the lac operator to 

                     inhibit transcription in E. coli. This inhibition can be 

                     relieved by adding lactose or 

                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."

     promoter        complement(2951..2981)

                     /label=lac promoter

                     /note="promoter for the E. coli lac operon"

     protein_bind    2996..3017

                     /label=CAP binding site

                     /bound_moiety="E. coli catabolite activator protein"

                     /note="CAP binding activates transcription in the presence 

                     of cAMP."

     rep_origin      complement(3305..3893)

                     /direction=LEFT

                     /label=ori

                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 

                     replication"

     CDS             complement(4064..4924)

                     /codon_start=1

                     /gene="bla"

                     /product="beta-lactamase"

                     /label=AmpR

                     /note="confers resistance to ampicillin, carbenicillin, and

                     related antibiotics"

                     /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI

                     ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVEYS

                     PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW

                     EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA

                     LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS

                     LIKHW"

     promoter        complement(4925..5029)

                     /gene="bla"

                     /label=AmpR promoter

     primer_bind     5503..5519

                     /label=M13 fwd

                     /note="common sequencing primer, one of multiple similar 

                     variants"

     promoter        5527..5545

                     /label=SP6 promoter

                     /note="promoter for bacteriophage SP6 RNA polymerase"

ORIGIN

        1 ccggagacta ctgttgttag acgacgaggc aggtccccta gaagaagaac tccctcgcct

       61 cgcagacgaa ggtctcaatc gccgcgtcgc agaagatctc aatctcggga atctcaatgt

      121 tagtattcct tggactcata aggtggggaa ctttactggg ctttattctt ctactgtacc

      181 tgtctttaat cctcattgga aaacaccatc ttttcctaat atacatttac accaagacat

      241 tatcaaaaaa tgtgaacagt ttgtaggccc actcacagtt aatgagaaaa gaagattgca

      301 attgattatg cctgccaggt tttatccaaa ggttaccaaa tatttaccat tggataaggg

      361 tattaaacct tattatccag aacatctagt taatcattac ttccaaacta gacactattt

      421 acacactcta tggaaggcgg gtatattata taagagagaa acaacacata gcgcctcatt

      481 ttgtgggtca ccatattctt gggaacaaga tctacagcat ggggcagaat ctttccacca

      541 gcaatcctct gggattcttt cccgaccacc agttggatcc agccttcaga gcaaacaccg

      601 caaatccaga ttgggacttc aatcccaaca aggacacctg gccagacgcc aacaaggtag

      661 gagctggagc attcgggctg ggtttcaccc caccgcacgg aggccttttg gggtggagcc

      721 ctcaggctca gggcatacta caaactttgc cagcaaatcc gcctcctgcc tccaccaatc

      781 gccagtcagg aaggcagcct accccgctgt ctccaccttt gagaaacact catcctcagg

      841 ccatgcagtg gaattccaca accttccacc aaactctgca agatcccaga gtgagaggcc

      901 tgtatttccc tgctggtggc tccagttcag gaacagtaaa ccctgttctg actactgcct

      961 ctcccttatc gtcaatcttc tcgaggattg gggaccctgc gctgaacatg gagaacatca

     1021 catcaggatt cctaggaccc cttctcgtgt tacaggcggg gtttttcttg ttgacaagaa

     1081 tcctcacaat accgcagagt ctagactcgt ggtggacttc tctcaatttt ctagggggaa

     1141 ctaccgtgtg tcttggccaa aattcgcagt ccccaacctc caatcactca ccaacctctt

     1201 gtcctccaac ttgtcctggt tatcgctgga tgtgtctgcg gcgttttatc atcttcctct

     1261 tcatcctgct gctatgcctc atcttcttgt tggttcttct ggactatcaa ggtatgttgc

     1321 ccgtttgtcc tctaattcca ggatcctcaa caaccagcac gggaccatgc cggacctgca

     1381 tgactactgc tcaaggaacc tctatgtatc cctcctgttg ctgtaccaaa ccttcggacg

     1441 gaaattgcac ctgtattccc atcccatcat cctgggcttt cggaaaattc ctatgggagt

     1501 gggcctcagc ccgtttctcc tggctcagtt tactagtgcc atttgttcag tggttcgtag

     1561 ggctttcccc cactgtttgg ctttcagtta tatggatgat gtggtattgg gggccaagtc

     1621 tgtacagcat cttgagtccc tttttaccgc tgttaccaat tttcttttgt ctttgggtat

     1681 acatttaaac cctaacaaaa caaagagatg gggttactct ctaaatttta tgggttatgt

     1741 cattggatgt tatgggtcct tgccacaaga acacatcata caaaaaatca aagaatgttt

     1801 tagaaaactt cctattaaca ggcctattga ttggaaagta tgtcaacgaa ttgtgggtct

     1861 tttgggtttt gctgcccctt ttacacaatg tggttatcct gcgttgatgc ctttgtatgc

     1921 atgtattcaa tctaagcagg ctttcacttt ctcgccaact tacaaggcct ttctgtgtaa

     1981 acaatacctg aacctttacc ccgttgcccg gcaacggcca ggtctgtgcc aagtgtttgc

     2041 tgacgcaacc cccactggct ggggcttggt catgggccat cagcgcatgc gtggaacctt

     2101 ttcggctcct ctgccgatcc atactgcgga actcctagcc gcttgttttg ctcgcagcag

     2161 gtctggagca aacattatcg ggactgataa ctctgttgtc ctatcccgca aatatacatc

     2221 gtttccatgg ctgctaggct gtgctgccaa ctggatcctg cgcgggacgt cctttgttta

     2281 cgtcccgtcg gcgctgaatc ctgcggacga cccttctcgg ggtcgcttgg gactctctcg

     2341 tccccttctc cgtctgccgt tccgaccgac cacggggcgc acctctcttt acgcggactc

     2401 cccgtctgtg ccttctcatc tgccggaccg tgtgcacttc gcttcacctc tgcacgtcgc

     2461 atggagacca ccgtgaacgc ccaccaaata ttgcccaagg tcttacataa gaggactctt

     2521 ggactctcag caatgtcaac gaccgacctt gaggcatact tcaaagactg tttgtttaaa

     2581 gactgggagg agttggggga ggagattagg ttaaaggtct ttgtactagg aggctgtagg

     2641 cataaattgg tctgcgcacc agcaccatgc aactttttca cctctgccta atcatctctt

     2701 gttcatgtcc tactgttcaa gcctccaagc tgtgccttgg gtggctttgg ggcatggaca

     2761 tcgaccctta taaagaattc ggagctactg tggagttact ctcgtttttg ccttctgact

     2821 tctttccttc agtacgagat cttctagata ccgcaagctt gtctccctat agtgagtcgt

     2881 attagagctt ggcgtaatca tggtcatagc tgtttcctgt gtgaaattgt tatccgctca

     2941 caattccaca caacatacga gccggaagca taaagtgtaa agcctggggt gcctaatgag

     3001 tgagctaact cacattaatt gcgttgcgct cactgcccgc tttccagtcg ggaaacctgt

     3061 cgtgccagct gcattaatga atcggccaac gcgcggggag aggcggtttg cgtattgggc

     3121 gctcttccgc ttcctcgctc actgactcgc tgcgctcggt cgttcggctg cggcgagcgg

     3181 tatcagctca ctcaaaggcg gtaatacggt tatccacaga atcaggggat aacgcaggaa

     3241 agaacatgtg agcaaaaggc cagcaaaagg ccaggaaccg taaaaaggcc gcgttgctgg

     3301 cgtttttcca taggctccgc ccccctgacg agcatcacaa aaatcgacgc tcaagtcaga

     3361 ggtggcgaaa cccgacagga ctataaagat accaggcgtt tccccctgga agctccctcg

     3421 tgcgctctcc tgttccgacc ctgccgctta ccggatacct gtccgccttt ctcccttcgg

     3481 gaagcgtggc gctttctcat agctcacgct gtaggtatct cagttcggtg taggtcgttc

     3541 gctccaagct gggctgtgtg cacgaacccc ccgttcagcc cgaccgctgc gccttatccg

     3601 gtaactatcg tcttgagtcc aacccggtaa gacacgactt atcgccactg gcagcagcca

     3661 ctggtaacag gattagcaga gcgaggtatg taggcggtgc tacagagttc ttgaagtggt

     3721 ggcctaacta cggctacact agaagaacag tatttggtat ctgcgctctg ctgaagccag

     3781 ttaccttcgg aaaaagagtt ggtagctctt gatccggcaa acaaaccacc gctggtagcg

     3841 gtggtttttt tgtttgcaag cagcagatta cgcgcagaaa aaaaggatct caagaagatc

     3901 ctttgatctt ttctacgggg tctgacgctc agtggaacga aaactcacgt taagggattt

     3961 tggtcatgag attatcaaaa aggatcttca cctagatcct tttaaattaa aaatgaagtt

     4021 ttaaatcaat ctaaagtata tatgagtaaa cttggtctga cagttaccaa tgcttaatca

     4081 gtgaggcacc tatctcagcg atctgtctat ttcgttcatc catagttgcc tgactccccg

     4141 tcgtgtagat aactacgata cgggagggct taccatctgg ccccagtgct gcaatgatac

     4201 cgcgagaccc acgctcaccg gctccagatt tatcagcaat aaaccagcca gccggaaggg

     4261 ccgagcgcag aagtggtcct gcaactttat ccgcctccat ccagtctatt aattgttgcc

     4321 gggaagctag agtaagtagt tcgccagtta atagtttgcg caacgttgtt gccattgcta

     4381 caggcatcgt ggtgtcacgc tcgtcgtttg gtatggcttc attcagctcc ggttcccaac

     4441 gatcaaggcg agttacatga tcccccatgt tgtgcaaaaa agcggttagc tccttcggtc

     4501 ctccgatcgt tgtcagaagt aagttggccg cagtgttatc actcatggtt atggcagcac

     4561 tgcataattc tcttactgtc atgccatccg taagatgctt ttctgtgact ggtgagtact

     4621 caaccaagtc attctgagaa tagtgtatgc ggcgaccgag ttgctcttgc ccggcgtcaa

     4681 tacgggataa taccgcgcca catagcagaa ctttaaaagt gctcatcatt ggaaaacgtt

     4741 cttcggggcg aaaactctca aggatcttac cgctgttgag atccagttcg atgtaaccca

     4801 ctcgtgcacc caactgatct tcagcatctt ttactttcac cagcgtttct gggtgagcaa

     4861 aaacaggaag gcaaaatgcc gcaaaaaagg gaataagggc gacacggaaa tgttgaatac

     4921 tcatactctt cctttttcaa tattattgaa gcatttatca gggttattgt ctcatgagcg

     4981 gatacatatt tgaatgtatt tagaaaaata aacaaatagg ggttccgcgc acatttcccc

     5041 gaaaagtgcc acctgacgtc taagaaacca ttattatcat gacattaacc tataaaaata

     5101 ggcgtatcac gaggcccttt cgtctcgcgc gtttcggtga tgacggtgaa aacctctgac

     5161 acatgcagct cccggagacg gtcacagctt gtctgtaagc ggatgccggg agcagacaag

     5221 cccgtcaggg cgcgtcagcg ggtgttggcg ggtgtcgggg ctggcttaac tatgcggcat

     5281 cagagcagat tgtactgaga gtgcaccata tgcggtgtga aataccgcac agatgcgtaa

     5341 ggagaaaata ccgcatcagg cgccattcgc cattcaggct gcgcaactgt tgggaagggc

     5401 gatcggtgcg ggcctcttcg ctattacgcc agctggcgaa agggggatgt gctgcaaggc

     5461 gattaagttg ggtaacgcca gggttttccc agtcacgacg ttgtaaaacg acggccagtg

     5521 aattggattt aggtgacact atagaatacg aattcgagct cgtattcaat ctaagcaggc

     5581 tttcactttc tcgccaactt acaaggcctt tctgtgtaaa caatacctga acctttaccc

     5641 cgttgcccgg caacggccag gtctgtgcca agtgtttgct gacgcaaccc ccactggctg

     5701 gggcttggtc atgggccatc agcgcatgcg tggaaccttt tcggctcctc tgccgatcca

     5761 tactgcggaa ctcctagccg cttgttttgc tcgcagcagg tctggagcaa acattatcgg

     5821 gactgataac tctgttgtcc tatcccgcaa atatacatcg tttccatggc tgctaggctg

     5881 tgctgccaac tggatcctgc gcgggacgtc ctttgtttac gtcccgtcgg cgctgaatcc

     5941 tgcggacgac ccttctcggg gtcgcttggg actctctcgt ccccttctcc gtctgccgtt

     6001 ccgaccgacc acggggcgca cctctcttta cgcggactcc ccgtctgtgc cttctcatct

     6061 gccggaccgt gtgcacttcg cttcacctct gcacgtcgca tggagaccac cgtgaacgcc

     6121 cactaaatat tgcccaaggt cttacataag aggactcttg gactctcagc aatgtcaacg

     6181 accgaccttg aggcatactt caaagactgt ttgtttaaag actgggagga gttgggggag

     6241 gagattaggt taaaggtctt tgtactagga ggctgtaggc ataaattggt ctgcgcacca

     6301 gcaccatgca actttttcac ctctgcctaa tcatctcttg ttcatgtcct actgttcaag

     6361 cctccaagct gtgccttggg tggctttggg gcatggacat cgacccttat aaagaatttg

     6421 gagctactgt ggagttactc tcgtttttgc cttctgactt ctttccttca gtacgagatc

     6481 ttctagatac cgcctcagct ctgtatcggg aagccttaga gtctcctgag cattgttcac

     6541 ctcaccatac tgcactcagg caagcaattc tttgctgggg ggaactaatg actctagcta

     6601 cctgggtggg tgttaatttg gaagatccag cgtctagaga cctagtagtc agttatgtca

     6661 acactaatat gggcctaaag ttcaggcaac tcttgtggtt tcacatttct tgtctcactt

     6721 ttggaagaga aacagttata gagtatttgg tgtctttcgg agtgtggatt cgcactcctc

     6781 cagcttatag accaccaaat gcccctatcc tatcaacact t

//

No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart