mAmetrine- N1

$160.00

  • Model: PVT10774
  • 50 Units in Stock
Ask a question


Add to Cart:

mAmetrine-N1


Catalog No. PVT10774
Packing 2ug

 

mAmetrine-N1 Information
Function Mammalian fluorescent plasmid
Resistance /
Screen /
Strain /
Culture temperature

 

mAmetrine-N1 Multiple cloning site

mAmetrine-N1-vector

 

mAmetrine-N1 Sequence

LOCUS       Exported                4732 bp ds-DNA     circular SYN 26-SEP-2017
DEFINITION  synthetic circular DNA
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 4732)
  AUTHORS   admin
  TITLE     Direct Submission
  JOURNAL   Exported 2015-10-18 
FEATURES             Location/Qualifiers
     source          1..4732
                     /organism="synthetic DNA construct"
                     /mol_type="other DNA"
     enhancer        61..364
                     /label=CMV enhancer
                     /note="CMV enhancer;human cytomegalovirus immediate early 
                     enhancer"
     promoter        365..568
                     /label=CMV promoter
                     /note="CMV promoter;human cytomegalovirus (CMV) immediate 
                     early promoter"
     misc_feature    591..671
                     /label=MCS
                     /note="MCS;multiple cloning site"
     CDS             679..1398
                     /codon_start=1
                     /product="yellow fluorescent protein with a large Stokes 
                     shift, excitable with violet light (Ai et al., 2008)"
                     /label=mAmetrine
                     /note="mammalian codon-optimized"
                     /translation="MVSKGEELFTGVVPILVELDGDVNGHKFSVRGEGEGDATNGKLTL
                     KFICTSGKLPVPWPTLVTTLSYGVQCFARYPDHMKQHDFFKSAMPEGYVQERTISFKDD
                     GSYRTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNMNVWDAYITADKQKNGIK
                     ANFKIEHNVEDGGVQLADAYQQNTPIGDGSVLLPDNHYLSFQSKLFKDPNEQRDHMVLL
                     EFVTAAGITPGMDELYK"
     polyA_signal    1520..1641
                     /label=SV40 poly(A) signal
                     /note="SV40 poly(A) signal;SV40 polyadenylation signal"
     rep_origin      complement(1648..2103)
                     /direction=LEFT
                     /label=f1 ori
                     /note="f1 ori;f1 bacteriophage origin of replication; arrow
                     indicates direction of (+) strand synthesis"
     promoter        2130..2234
                     /gene="bla"
                     /label=AmpR promoter
                     /note="AmpR promoter"
     promoter        2236..2593
                     /label=SV40 promoter
                     /note="SV40 promoter;SV40 enhancer and early promoter"
     rep_origin      2444..2579
                     /label=SV40 ori
                     /note="SV40 ori;SV40 origin of replication"
     CDS             2628..3422
                     /codon_start=1
                     /gene="aph(3')-II (or nptII)"
                     /product="aminoglycoside phosphotransferase from Tn5"
                     /label=NeoR/KanR
                     /note="NeoR/KanR;confers resistance to neomycin, kanamycin,
                     and G418 (Geneticin(R))"
                     /translation="MIEQDGLHAGSPAAWVERLFGYDWAQQTIGCSDAAVFRLSAQGRP
                     VLFVKTDLSGALNELQDEAARLSWLATTGVPCAAVLDVVTEAGRDWLLLGEVPGQDLLS
                     SHLAPAEKVSIMADAMRRLHTLDPATCPFDHQAKHRIERARTRMEAGLVDQDDLDEEHQ
                     GLAPAELFARLKASMPDGEDLVVTHGDACLPNIMVENGRFSGFIDCGRLGVADRYQDIA
                     LATRDIAEELGGEWADRFLVLYGIAAPDSQRIAFYRLLDEFF"
     polyA_signal    3654..3701
                     /label=HSV TK poly(A) signal
                     /note="HSV TK poly(A) signal;herpesvirus thymidine kinase 
                     polyadenylation signal"
     rep_origin      4030..4618
                     /direction=RIGHT
                     /label=ori
                     /note="ori;high-copy-number ColE1/pMB1/pBR322/pUC origin of
                     replication"
ORIGIN
        1 tagttattaa tagtaatcaa ttacggggtc attagttcat agcccatata tggagttccg
       61 cgttacataa cttacggtaa atggcccgcc tggctgaccg cccaacgacc cccgcccatt
      121 gacgtcaata atgacgtatg ttcccatagt aacgccaata gggactttcc attgacgtca
      181 atgggtggag tatttacggt aaactgccca cttggcagta catcaagtgt atcatatgcc
      241 aagtacgccc cctattgacg tcaatgacgg taaatggccc gcctggcatt atgcccagta
      301 catgacctta tgggactttc ctacttggca gtacatctac gtattagtca tcgctattac
      361 catggtgatg cggttttggc agtacatcaa tgggcgtgga tagcggtttg actcacgggg
      421 atttccaagt ctccacccca ttgacgtcaa tgggagtttg ttttggcacc aaaatcaacg
      481 ggactttcca aaatgtcgta acaactccgc cccattgacg caaatgggcg gtaggcgtgt
      541 acggtgggag gtctatataa gcagagctgg tttagtgaac cgtcagatcc gctagcgcta
      601 ccggactcag atctcgagct caagcttcga attctgcagt cgacggtacc gcgggcccgg
      661 gatccaccgg tcgccaccat ggtgagcaag ggcgaggagc tgttcaccgg ggtggtgccc
      721 atcctggtcg agctggacgg cgacgtaaac ggccacaagt tcagcgtgcg cggcgagggc
      781 gagggcgatg ccaccaacgg caagctgacc ctgaagttca tctgcacctc cggcaagctg
      841 cccgtgccct ggcccaccct cgtgaccacc ctgtcttacg gcgtgcagtg cttcgcccgc
      901 taccccgacc acatgaagca gcacgacttc ttcaagtccg ccatgcccga aggctacgtc
      961 caggagcgca ccatctcctt caaggacgac ggcagctaca ggacccgcgc cgaggtgaag
     1021 ttcgagggcg acaccctggt gaaccgcatc gagctgaagg gcatcgactt caaggaggac
     1081 ggcaacatcc tggggcacaa gctggagtac aacatgaacg tgtgggacgc gtatatcacg
     1141 gccgacaagc agaagaacgg catcaaagcg aacttcaaga tcgagcacaa cgtcgaggac
     1201 ggcggcgtgc agctcgccga cgcgtaccag cagaacaccc ccatcggcga cggctccgtg
     1261 ctgctgcctg acaaccacta cctgagcttc cagagcaagc tgttcaaaga ccccaacgag
     1321 cagcgcgatc acatggtcct gctggagttc gttaccgccg ccgggatcac tcccggcatg
     1381 gacgagctgt acaagtaagc ggccgcgact ctagatcata atcagccata ccacatttgt
     1441 agaggtttta cttgctttaa aaaacctccc acacctcccc ctgaacctga aacataaaat
     1501 gaatgcaatt gttgttgtta acttgtttat tgcagcttat aatggttaca aataaagcaa
     1561 tagcatcaca aatttcacaa ataaagcatt tttttcactg cattctagtt gtggtttgtc
     1621 caaactcatc aatgtatctt aaggcgtaaa ttgtaagcgt taatattttg ttaaaattcg
     1681 cgttaaattt ttgttaaatc agctcatttt ttaaccaata ggccgaaatc ggcaaaatcc
     1741 cttataaatc aaaagaatag accgagatag ggttgagtgt tgttccagtt tggaacaaga
     1801 gtccactatt aaagaacgtg gactccaacg tcaaagggcg aaaaaccgtc tatcagggcg
    &
No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart