p2Luc

$193.00

  • Model: PVT10839
  • 49 Units in Stock
Ask a question


Add to Cart:

p2Luc

PVT10839        Packing 2ug

 

p2Luc Information

Promoter: SV40

Replicator: pUC

Terminator: SV40 poly (A) signal

Prokaryotic resistance: Amp

Eukaryotic resistance: luciferase Luc

Clone strain: DH5a

Culture condition: 37℃

Plasmid host: mammalian cell

Plasmid usage: signal report

Clip type:-

Fragment species:-

Prokaryotic resistance: Amp

Eukaryotic resistance:-

Fluorescent label: Fluc

 

p2Luc Sequence

LOCUS       Exported                5397 bp ds-DNA     circular SYN 17-JAN-2018

DEFINITION  synthetic circular DNA

FEATURES             Location/Qualifiers

     source          1..5397

                     /organism="synthetic DNA construct"

                     /mol_type="other DNA"

     promoter        66..423

                     /note="SV40 promoter"

                     /note="SV40 enhancer and early promoter"

     rep_origin      274..409

                     /note="SV40 ori"

                     /note="SV40 origin of replication"

     intron          493..625

                     /note="chimeric intron"

                     /note="chimera between introns from human beta-globin and 

                     immunoglobulin heavy chain genes"

     promoter        670..688

                     /note="T7 promoter"

                     /note="promoter for bacteriophage T7 RNA polymerase"

     CDS             698..1630

                     /codon_start=1

                     /product="luciferase from the anthozoan coelenterate 

                     Renilla reniformis (sea pansy)"

                     /note="Rluc"

                     /translation="MTSKVYDPEQRKRMITGPQWWARCKQMNVLDSFINYYDSEKHAEN

                     AVIFLHGNAASSYLWRHVVPHIEPVARCIIPDLIGMGKSGKSGNGSYRLLDHYKYLTAW

                     FELLNLPKKIIFVGHDWGACLAFHYSYEHQDKIKAIVHAESVVDVIESWDEWPDIEEDI

                     ALIKSEEGEKMVLENNFFVETMLPSKIMRKLEPEEFAAYLEPFKEKGEVRRPTLSWPRE

                     IPLVKGGKPDVVQIVRNYNAYLRASDDLPKMFIESDPGFFSNAIVEGAKKFPNTEFVKV

                     KGLHFSQEDAPDEMGKYIKSFVERVLKNEQ"

     misc_feature    1633..1662

                     /note="MCS"

     CDS             1663..3312

                     /codon_start=1

                     /gene="luc"

                     /product="firefly luciferase"

                     /note="luciferase"

                     /translation="EDAKNIKKGPAPFYPLEDGTAGEQLHKAMKRYALVPGTIAFTDAH

                     IEVNITYAEYFEMSVRLAEAMKRYGLNTNHRIVVCSENSLQFFMPVLGALFIGVAVAPA

                     NDIYNERELLNSMNISQPTVVFVSKKGLQKILNVQKKLPIIQKIIIMDSKTDYQGFQSM

                     YTFVTSHLPPGFNEYDFVPESFDRDKTIALIMNSSGSTGLPKGVALPHRTACVRFSHAR

                     DPIFGNQIIPDTAILSVVPFHHGFGMFTTLGYLICGFRVVLMYRFEEELFLRSLQDYKI

                     QSALLVPTLFSFFAKSTLIDKYDLSNLHEIASGGAPLSKEVGEAVAKRFHLPGIRQGYG

                     LTETTSAILITPEGDDKPGAVGKVVPFFEAKVVDLDTGKTLGVNQRGELCVRGPMIMSG

                     YVNNPEATNALIDKDGWLHSGDIAYWDEDEHFFIVDRLKSLIKYKGYQVAPAELESILL

                     QHPNIFDAGVAGLPDDDAGELPAAVVVLEHGKTMTEKEIVDYVASQVTTAKKLRGGVVF

                     VDEVPKGLTGKLDARKIREILIKAKKGGKSKL"

     polyA_signal    3352..3473

                     /note="SV40 poly(A) signal"

                     /note="SV40 polyadenylation signal"

     promoter        3606..3710

                     /gene="bla"

                     /note="AmpR promoter"

     CDS             3711..4571

                     /codon_start=1

                     /gene="bla"

                     /product="beta-lactamase"

                     /note="AmpR"

                     /note="confers resistance to ampicillin, carbenicillin, and

                     related antibiotics"

                     /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI

                     ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVEYS

                     PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW

                     EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA

                     LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS

                     LIKHW"

     rep_origin      4742..5330

                     /direction=RIGHT

                     /note="ori"

                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 

                     replication"

ORIGIN

        1 agatcgatct gcgcagcacc atggcctgaa ataacctctg aaagaggaac ttggttaggt

       61 accttctgag gcggaaagaa ccagctgtgg aatgtgtgtc agttagggtg tggaaagtcc

      121 ccaggctccc cagcaggcag aagtatgcaa agcatgcatc tcaattagtc agcaaccagg

      181 tgtggaaagt ccccaggctc cccagcaggc agaagtatgc aaagcatgca tctcaattag

      241 tcagcaacca tagtcccgcc cctaactccg cccatcccgc ccctaactcc gcccagttcc

      301 gcccattctc cgccccatgg ctgactaatt ttttttattt atgcagaggc cgaggccgcc

      361 tcggcctctg agctattcca gaagtagtga ggaggctttt ttggaggcct aggcttttgc

      421 aaaaagcttg attcttctga cacaacagtc tcgaacttaa gctgcagaag ttggtcgtga

      481 ggcactgggc aggtaagtat caaggttaca agacaggttt aaggagacca atagaaactg

      541 ggcttgtcga gacagagaag actcttgcgt ttctgatagg cacctattgg tcttactgac

      601 atccactttg cctttctctc cacaggtgtc cactcccagt tcaattacag ctcttaaggc

      661 tagagtactt aatacgactc actataggct agccaccatg acttcgaaag tttatgatcc

      721 agaacaaagg aaacggatga taactggtcc gcagtggtgg gccagatgta aacaaatgaa

      781 tgttcttgat tcatttatta attattatga ttcagaaaaa catgcagaaa atgctgttat

      841 ttttttacat ggtaacgcgg cctcttctta tttatggcga catgttgtgc cacatattga

      901 gccagtagcg cggtgtatta taccagacct tattggtatg ggcaaatcag gcaaatctgg

      961 taatggttct tataggttac ttgatcatta caaatatctt actgcatggt ttgaacttct

     1021 taatttacca aagaagatca tttttgtcgg ccatgattgg ggtgcttgtt tggcatttca

     1081 ttatagctat gagcatcaag ataagatcaa agcaatagtt cacgctgaaa gtgtagtaga

     1141 tgtgattgaa tcatgggatg aatggcctga tattgaagaa gatattgcgt tgatcaaatc

     1201 tgaagaagga gaaaaaatgg ttttggagaa taacttcttc gtggaaacca tgttgccatc

     1261 aaaaatcatg agaaagttag aaccagaaga atttgcagca tatcttgaac cattcaaaga

     1321 gaaaggtgaa gttcgtcgtc caacattatc atggcctcgt gaaatcccgt tagtaaaagg

     1381 tggtaaacct gacgttgtac aaattgttag gaattataat gcttatctac gtgcaagtga

     1441 tgatttacca aaaatgttta ttgaatcgga cccaggattc ttttccaatg ctattgttga

     1501 aggtgccaag aagtttccta atactgaatt tgtcaaagta aaaggtcttc atttttcgca

     1561 agaagatgca cctgatgaaa tgggaaaata tatcaaatcg ttcgttgagc gagttctcaa

     1621 aaatgaacaa atgtcgacgg atccttcaac ttccctgagc tcgaagacgc caaaaacata

     1681 aagaaaggcc cggcgccatt ctatcctcta gaggatggaa ccgctggaga gcaactgcat

     1741 aaggctatga agagatacgc cctggttcct ggaacaattg cttttacaga tgcacatatc

     1801 gaggtgaaca tcacgtacgc ggaatacttc gaaatgtccg ttcggttggc agaagctatg

     1861 aaacgatatg ggctgaatac aaatcacaga atcgtcgtat gcagtgaaaa ctctcttcaa

     1921 ttctttatgc cggtgttggg cgcgttattt atcggagttg cagttgcgcc cgcgaacgac

     1981 atttataatg aacgtgaatt gctcaacagt atgaacattt cgcagcctac cgtagtgttt

     2041 gtttccaaaa aggggttgca aaaaattttg aacgtgcaaa aaaaattacc aataatccag

     2101 aaaattatta tcatggattc taaaacggat taccagggat ttcagtcgat gtacacgttc

     2161 gtcacatctc atctacctcc cggttttaat gaatacgatt ttgtaccaga gtcctttgat

     2221 cgtgacaaaa caattgcact gataatgaat tcctctggat ctactgggtt acctaagggt

     2281 gtggcccttc cgcatagaac tgcctgcgtc agattctcgc atgccagaga tcctattttt

     2341 ggcaatcaaa tcattccgga tactgcgatt ttaagtgttg ttccattcca tcacggtttt

     2401 ggaatgttta ctacactcgg atatttgata tgtggatttc gagtcgtctt aatgtataga

     2461 tttgaagaag agctgttttt acgatccctt caggattaca aaattcaaag tgcgttgcta

     2521 gtaccaaccc tattttcatt cttcgccaaa agcactctga ttgacaaata cgatttatct

     2581 aatttacacg aaattgcttc tgggggcgca cctctttcga aagaagtcgg ggaagcggtt

     2641 gcaaaacgct tccatcttcc agggatacga caaggatatg ggctcactga gactacatca

     2701 gctattctga ttacacccga gggggatgat aaaccgggcg cggtcggtaa agttgttcca

     2761 ttttttgaag cgaaggttgt ggatctggat accgggaaaa cgctgggcgt taatcagaga

     2821 ggcgaattat gtgtcagagg acctatgatt atgtccggtt atgtaaacaa tccggaagcg

     2881 accaacgcct tgattgacaa ggatggatgg ctacattctg gagacatagc ttactgggac

     2941 gaagacgaac acttcttcat agttgaccgc ttgaagtctt taattaaata caaaggatat

     3001 caggtggccc ccgctgaatt ggaatcgata ttgttacaac accccaacat cttcgacgcg

     3061 ggcgtggcag gtcttcccga cgatgacgcc ggtgaacttc ccgccgccgt tgttgttttg

     3121 gagcacggaa agacgatgac ggaaaaagag atcgtggatt acgtcgccag tcaagtaaca

     3181 accgcgaaaa agttgcgcgg aggagttgtg tttgtggacg aagtaccgaa aggtcttacc

     3241 ggaaaactcg acgcaagaaa aatcagagag atcctcataa aggccaagaa gggcggaaag

     3301 tccaaattgt aacacgtgta attctagagc ggccgcttcg agcagacatg ataagataca

     3361 ttgatgagtt tggacaaacc acaactagaa tgcagtgaaa aaaatgcttt atttgtgaaa

     3421 tttgtgatgc tattgcttta tttgtaacca ttataagctg caataaacaa gttaacaaca

     3481 acaattgcat tcattttatg tttcaggttc agggggaggt gtgggaggtt ttttaaagca

     3541 agtaaaacct ctacaaatgt ggtaaaatcg ataaggatcc aggtggcact tttcggggaa

     3601 atgtgcgcgg aacccctatt tgtttatttt tctaaataca ttcaaatatg tatccgctca

     3661 tgagacaata accctgataa atgcttcaat aatattgaaa aaggaagagt atgagtattc

     3721 aacatttccg tgtcgccctt attccctttt ttgcggcatt ttgccttcct gtttttgctc

     3781 acccagaaac gctggtgaaa gtaaaagatg ctgaagatca gttgggtgca cgagtgggtt

     3841 acatcgaact ggatctcaac agcggtaaga tccttgagag ttttcgcccc gaagaacgtt

     3901 ttccaatgat gagcactttt aaagttctgc tatgtggcgc ggtattatcc cgtattgacg

     3961 ccgggcaaga gcaactcggt cgccgcatac actattctca gaatgacttg gttgagtact

     4021 caccagtcac agaaaagcat cttacggatg gcatgacagt aagagaatta tgcagtgctg

     4081 ccataaccat gagtgataac actgcggcca acttacttct gacaacgatc ggaggaccga

     4141 aggagctaac cgcttttttg cacaacatgg gggatcatgt aactcgcctt gatcgttggg

     4201 aaccggagct gaatgaagcc ataccaaacg acgagcgtga caccacgatg cctgtagcaa

     4261 tggcaacaac gttgcgcaaa ctattaactg gcgaactact tactctagct tcccggcaac

     4321 aattaataga ctggatggag gcggataaag ttgcaggacc acttctgcgc tcggcccttc

     4381 cggctggctg gtttattgct gataaatctg gagccggtga gcgtgggtct cgcggtatca

     4441 ttgcagcact ggggccagat ggtaagccct cccgtatcgt agttatctac acgacgggga

     4501 gtcaggcaac tatggatgaa cgaaatagac agatcgctga gataggtgcc tcactgatta

     4561 agcattggta actgtcagac caagtttact catatatact ttagattgat ttaaaacttc

     4621 atttttaatt taaaaggatc taggtgaaga tcctttttga taatctcatg accaaaatcc

     4681 cttaacgtga gttttcgttc cactgagcgt cagaccccgt agaaaagatc aaaggatctt

     4741 cttgagatcc tttttttctg cgcgtaatct gctgcttgca aacaaaaaaa ccaccgctac

     4801 cagcggtggt ttgtttgccg gatcaagagc taccaactct ttttccgaag gtaactggct

     4861 tcagcagagc gcagatacca aatactgtcc ttctagtgta gccgtagtta ggccaccact

     4921 tcaagaactc tgtagcaccg cctacatacc tcgctctgct aatcctgtta ccagtggctg

     4981 ctgccagtgg cgataagtcg tgtcttaccg ggttggactc aagacgatag ttaccggata

     5041 aggcgcagcg gtcgggctga acggggggtt cgtgcacaca gcccagcttg gagcgaacga

     5101 cctacaccga actgagatac ctacagcgtg agctatgaga aagcgccacg cttcccgaag

     5161 ggagaaaggc ggacaggtat ccggtaagcg gcagggtcgg aacaggagag cgcacgaggg

     5221 agcttccagg gggaaacgcc tggtatcttt atagtcctgt cgggtttcgc cacctctgac

     5281 ttgagcgtcg atttttgtga tgctcgtcag gggggcggag cctatggaaa aacgccagca

     5341 acgcggcctt tttacggttc ctggcctttt gctggccttt tgctcacatg gctcgac

//

No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart