p414- TEF1p- Cas9- CYC1t

$215.00

  • Model: PVT11277
  • 50 Units in Stock
Ask a question


Add to Cart:

p414-TEF1p-Cas9-CYC1t

Catalog No. PVT11277
Packing 2ug

 

p414-TEF1p-Cas9-CYC1t Information


Function yeast Editing plasmids

Promoter: TEF1

Replicon:    2μ

Prokaryotic resistance: ampicillin Amp

Screening markers: TRP1

Cloned strain: yeast

Culture conditions: 30 degrees centigrade

 

p414-TEF1p-Cas9-CYC1t Description

P414-TEF1p-Cas9-CYC1t is a yeast yeast gene editing Cas9 expression plasmid.

 

p414-TEF1p-Cas9-CYC1t Sequence

LOCUS       Exported                9524 bp ds-DNA     circular SYN 06-JAN-2018

DEFINITION  synthetic circular DNA

FEATURES             Location/Qualifiers

     source          1..9524

                     /organism="synthetic DNA construct"

                     /mol_type="other DNA"

     misc_feature    69..572

                     /label=CEN/ARS

                     /note="S. cerevisiae CEN6 centromere fused to an 

                     autonomously replicating sequence"

     promoter        609..713

                     /gene="bla"

                     /label=AmpR promoter

     CDS             714..1574

                     /codon_start=1

                     /gene="bla"

                     /product="beta-lactamase"

                     /label=AmpR

                     /note="confers resistance to ampicillin, carbenicillin, and

                     related antibiotics"

                     /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI

                     ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVEYS

                     PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW

                     EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA

                     LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS

                     LIKHW"

     rep_origin      1745..2333

                     /direction=RIGHT

                     /label=ori

                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 

                     replication"

     promoter        2792..3190

                     /gene="S. cerevisiae TEF1"

                     /label=TEF1 promoter

                     /note="promoter for EF-1-alpha"

     CDS             3222..7325

                     /codon_start=1

                     /product="Cas9 (Csn1) endonuclease from the Streptococcus 

                     pyogenes Type II CRISPR/Cas system"

                     /label=Cas9

                     /note="generates RNA-guided double strand breaks in DNA"

                     /translation="MDKKYSIGLDIGTNSVGWAVITDEYKVPSKKFKVLGNTDRHSIKK

                     NLIGALLFDSGETAEATRLKRTARRRYTRRKNRICYLQEIFSNEMAKVDDSFFHRLEES

                     FLVEEDKKHERHPIFGNIVDEVAYHEKYPTIYHLRKKLVDSTDKADLRLIYLALAHMIK

                     FRGHFLIEGDLNPDNSDVDKLFIQLVQTYNQLFEENPINASGVDAKAILSARLSKSRRL

                     ENLIAQLPGEKKNGLFGNLIALSLGLTPNFKSNFDLAEDAKLQLSKDTYDDDLDNLLAQ

                     IGDQYADLFLAAKNLSDAILLSDILRVNTEITKAPLSASMIKRYDEHHQDLTLLKALVR

                     QQLPEKYKEIFFDQSKNGYAGYIDGGASQEEFYKFIKPILEKMDGTEELLVKLNREDLL

                     RKQRTFDNGSIPHQIHLGELHAILRRQEDFYPFLKDNREKIEKILTFRIPYYVGPLARG

                     NSRFAWMTRKSEETITPWNFEEVVDKGASAQSFIERMTNFDKNLPNEKVLPKHSLLYEY

                     FTVYNELTKVKYVTEGMRKPAFLSGEQKKAIVDLLFKTNRKVTVKQLKEDYFKKIECFD

                     SVEISGVEDRFNASLGTYHDLLKIIKDKDFLDNEENEDILEDIVLTLTLFEDREMIEER

                     LKTYAHLFDDKVMKQLKRRRYTGWGRLSRKLINGIRDKQSGKTILDFLKSDGFANRNFM

                     QLIHDDSLTFKEDIQKAQVSGQGDSLHEHIANLAGSPAIKKGILQTVKVVDELVKVMGR

                     HKPENIVIEMARENQTTQKGQKNSRERMKRIEEGIKELGSQILKEHPVENTQLQNEKLY

                     LYYLQNGRDMYVDQELDINRLSDYDVDHIVPQSFLKDDSIDNKVLTRSDKNRGKSDNVP

                     SEEVVKKMKNYWRQLLNAKLITQRKFDNLTKAERGGLSELDKAGFIKRQLVETRQITKH

                     VAQILDSRMNTKYDENDKLIREVKVITLKSKLVSDFRKDFQFYKVREINNYHHAHDAYL

                     NAVVGTALIKKYPKLESEFVYGDYKVYDVRKMIAKSEQEIGKATAKYFFYSNIMNFFKT

                     EITLANGEIRKRPLIETNGETGEIVWDKGRDFATVRKVLSMPQVNIVKKTEVQTGGFSK

                     ESILPKRNSDKLIARKKDWDPKKYGGFDSPTVAYSVLVVAKVEKGKSKKLKSVKELLGI

                     TIMERSSFEKNPIDFLEAKGYKEVKKDLIIKLPKYSLFELENGRKRMLASAGELQKGNE

                     LALPSKYVNFLYLASHYEKLKGSPEDNEQKQLFVEQHKHYLDEIIEQISEFSKRVILAD

                     ANLDKVLSAYNKHRDKPIREQAENIIHLFTLTNLGAPAAFKYFDTTIDRKRYTSTKEVL

                     DATLIHQSITGLYETRIDLSQLGGD"

     CDS             7338..7358

                     /codon_start=1

                     /product="nuclear localization signal of SV40 (simian virus

                     40) large T antigen"

                     /label=SV40 NLS

                     /translation="PKKKRKV"

     terminator      7374..7621

                     /gene="S. cerevisiae CYC1"

                     /label=CYC1 terminator

                     /note="transcription terminator for CYC1"

     rep_origin      7829..8284

                     /direction=RIGHT

                     /label=f1 ori

                     /note="f1 bacteriophage origin of replication; arrow 

                     indicates direction of (+) strand synthesis"

     CDS             complement(8383..9057)

                     /codon_start=1

                     /gene="S. cerevisiae TRP1"

                     /product="phosphoribosylanthranilate isomerase, required 

                     for tryptophan biosynthesis"

                     /label=TRP1

                     /note="yeast auxotrophic marker"

                     /translation="MSVINFTGSSGPLVKVCGLQSTEAAECALDSDADLLGIICVPNRK

                     RTIDPVIARKISSLVKAYKNSSGTPKYLVGVFRNQPKEDVLALVNDYGIDIVQLHGDES

                     WQEYQEFLGLPVIKRLVFPKDCNILLSAASQKPHSFIPLFDSEAGGTGELLDWNSISDW

                     VGRQESPESLHFMLAGGLTPENVGDALRLNGVIGVDVSGGVETNGVKDSNKIANFVKNA

                     KK"

     promoter        complement(9058..9338)

                     /gene="S. cerevisiae TRP1"

                     /label=TRP1 promoter

ORIGIN

        1 gacgaaaggg cctcgtgata cgcctatttt tataggttaa tgtcatgata ataatggttt

       61 cttagacgga tcgcttgcct gtaacttaca cgcgcctcgt atcttttaat gatggaataa

      121 tttgggaatt tactctgtgt ttatttattt ttatgttttg tatttggatt ttagaaagta

      181 aataaagaag gtagaagagt tacggaatga agaaaaaaaa ataaacaaag gtttaaaaaa

      241 tttcaacaaa aagcgtactt tacatatata tttattagac aagaaaagca gattaaatag

      301 atatacattc gattaacgat aagtaaaatg taaaatcaca ggattttcgt gtgtggtctt

      361 ctacacagac aagatgaaac aattcggcat taatacctga gagcaggaag agcaagataa

      421 aaggtagtat ttgttggcga tccccctaga gtcttttaca tcttcggaaa acaaaaacta

      481 ttttttcttt aatttctttt tttactttct atttttaatt tatatattta tattaaaaaa

      541 tttaaattat aattattttt atagcacgtg atgaaaagga cccaggtggc acttttcggg

      601 gaaatgtgcg cggaacccct atttgtttat ttttctaaat acattcaaat atgtatccgc

      661 tcatgagaca ataaccctga taaatgcttc aataatattg aaaaaggaag agtatgagta

      721 ttcaacattt ccgtgtcgcc cttattccct tttttgcggc attttgcctt cctgtttttg

      781 ctcacccaga aacgctggtg aaagtaaaag atgctgaaga tcagttgggt gcacgagtgg

      841 gttacatcga actggatctc aacagcggta agatccttga gagttttcgc cccgaagaac

      901 gttttccaat gatgagcact tttaaagttc tgctatgtgg cgcggtatta tcccgtattg

      961 acgccgggca agagcaactc ggtcgccgca tacactattc tcagaatgac ttggttgagt

     1021 actcaccagt cacagaaaag catcttacgg atggcatgac agtaagagaa ttatgcagtg

     1081 ctgccataac catgagtgat aacactgcgg ccaacttact tctgacaacg atcggaggac

     1141 cgaaggagct aaccgctttt ttgcacaaca tgggggatca tgtaactcgc cttgatcgtt

     1201 gggaaccgga gctgaatgaa gccataccaa acgacgagcg tgacaccacg atgcctgtag

     1261 caatggcaac aacgttgcgc aaactattaa ctggcgaact acttactcta gcttcccggc

     1321 aacaattaat agactggatg gaggcggata aagttgcagg accacttctg cgctcggccc

     1381 ttccggctgg ctggtttatt gctgataaat ctggagccgg tgagcgtggg tctcgcggta

     1441 tcattgcagc actggggcca gatggtaagc cctcccgtat cgtagttatc tacacgacgg

     1501 ggagtcaggc aactatggat gaacgaaata gacagatcgc tgagataggt gcctcactga

     1561 ttaagcattg gtaactgtca gaccaagttt actcatatat actttagatt gatttaaaac

     1621 ttcattttta atttaaaagg atctaggtga agatcctttt tgataatctc atgaccaaaa

     1681 tcccttaacg tgagttttcg ttccactgag cgtcagaccc cgtagaaaag atcaaaggat

     1741 cttcttgaga tccttttttt ctgcgcgtaa tctgctgctt gcaaacaaaa aaaccaccgc

     1801 taccagcggt ggtttgtttg ccggatcaag agctaccaac tctttttccg aaggtaactg

     1861 gcttcagcag agcgcagata ccaaatactg tccttctagt gtagccgtag ttaggccacc

     1921 acttcaagaa ctctgtagca ccgcctacat acctcgctct gctaatcctg ttaccagtgg

     1981 ctgctgccag tggcgataag tcgtgtctta ccgggttgga ctcaagacga tagttaccgg

     2041 ataaggcgca gcggtcgggc tgaacggggg gttcgtgcac acagcccagc ttggagcgaa

     2101 cgacctacac cgaactgaga tacctacagc gtgagctatg agaaagcgcc acgcttcccg

     2161 aagggagaaa ggcggacagg tatccggtaa gcggcagggt cggaacagga gagcgcacga

     2221 gggagcttcc agggggaaac gcctggtatc tttatagtcc tgtcgggttt cgccacctct

     2281 gacttgagcg tcgatttttg tgatgctcgt caggggggcg gagcctatgg aaaaacgcca

     2341 gcaacgcggc ctttttacgg ttcctggcct tttgctggcc ttttgctcac atgttctttc

     2401 ctgcgttatc ccctgattct gtggataacc gtattaccgc ctttgagtga gctgataccg

     2461 ctcgccgcag ccgaacgacc gagcgcagcg agtcagtgag cgaggaagcg gaagagcgcc

     2521 caatacgcaa accgcctctc cccgcgcgtt ggccgattca ttaatgcagc tggcacgaca

     2581 ggtttcccga ctggaaagcg ggcagtgagc gcaacgcaat taatgtgagt tacctcactc

     2641 attaggcacc ccaggcttta cactttatgc ttccggctcc tatgttgtgt ggaattgtga

     2701 gcggataaca atttcacaca ggaaacagct atgaccatga ttacgccaag cgcgcaatta

     2761 accctcacta aagggaacaa aagctggagc tcatagcttc aaaatgtttc tactcctttt

     2821 ttactcttcc agattttctc ggactccgcg catcgccgta ccacttcaaa acacccaagc

     2881 acagcatact aaatttcccc tctttcttcc tctagggtgt cgttaattac ccgtactaaa

     2941 ggtttggaaa agaaaaaaga gaccgcctcg tttctttttc ttcgtcgaaa aaggcaataa

     3001 aaatttttat cacgtttctt tttcttgaaa attttttttt tgattttttt ctctttcgat

     3061 gacctcccat tgatatttaa gttaataaac ggtcttcaat ttctcaagtt tcagtttcat

     3121 ttttcttgtt ctattacaac tttttttact tcttgctcat tagaaagaaa gcatagcaat

     3181 ctaatctaag ttttctagaa ctagtggatc ccccgggaaa aatggacaag aagtactcca

     3241 ttgggctcga tatcggcaca aacagcgtcg gttgggccgt cattacggac gagtacaagg

     3301 tgccgagcaa aaaattcaaa gttctgggca ataccgatcg ccacagcata aagaagaacc

     3361 tcattggcgc cctcctgttc gactccgggg agacggccga agccacgcgg ctcaaaagaa

     3421 cagcacggcg cagatatacc cgcagaaaga atcggatctg ctacctgcag gagatcttta

     3481 gtaatgagat ggctaaggtg gatgactctt tcttccatag gctggaggag tcctttttgg

     3541 tggaggagga taaaaagcac gagcgccacc caatctttgg caatatcgtg gacgaggtgg

     3601 cgtaccatga aaagtaccca accatatatc atctgaggaa gaagcttgta gacagtactg

     3661 ataaggctga cttgcggttg atctatctcg cgctggcgca tatgatcaaa tttcggggac

     3721 acttcctcat cgagggggac ctgaacccag acaacagcga tgtcgacaaa ctctttatcc

     3781 aactggttca gacttacaat cagcttttcg aagagaaccc gatcaacgca tccggagttg

     3841 acgccaaagc aatcctgagc gctaggctgt ccaaatcccg gcggctcgaa aacctcatcg

     3901 cacagctccc tggggagaag aagaacggcc tgtttggtaa tcttatcgcc ctgtcactcg

     3961 ggctgacccc caactttaaa tctaacttcg acctggccga agatgccaag cttcaactga

     4021 gcaaagacac ctacgatgat gatctcgaca atctgctggc ccagatcggc gaccagtacg

     4081 cagacctttt tttggcggca aagaacctgt cagacgccat tctgctgagt gatattctgc

     4141 gagtgaacac ggagatcacc aaagctccgc tgagcgctag tatgatcaag cgctatgatg

     4201 agcaccacca agacttgact ttgctgaagg cccttgtcag acagcaactg cctgagaagt

     4261 acaaggaaat tttcttcgat cagtctaaaa atggctacgc cggatacatt gacggcggag

     4321 caagccagga ggaattttac aaatttatta agcccatctt ggaaaaaatg gacggcaccg

     4381 aggagctgct ggtaaagctt aacagagaag atctgttgcg caaacagcgc actttcgaca

     4441 atggaagcat cccccaccag attcacctgg gcgaactgca cgctatcctc aggcggcaag

     4501 aggatttcta cccctttttg aaagataaca gggaaaagat tgagaaaatc ctcacatttc

     4561 ggatacccta ctatgtaggc cccctcgccc ggggaaattc cagattcgcg tggatgactc

     4621 gcaaatcaga agagaccatc actccctgga acttcgagga agtcgtggat aagggggcct

     4681 ctgcccagtc cttcatcgaa aggatgacta actttgataa aaatctgcct aacgaaaagg

     4741 tgcttcctaa acactctctg ctgtacgagt acttcacagt ttataacgag ctcaccaagg

     4801 tcaaatacgt cacagaaggg atgagaaagc cagcattcct gtctggagag cagaagaaag

     4861 ctatcgtgga cctcctcttc aagacgaacc ggaaagttac cgtgaaacag ctcaaagaag

     4921 actatttcaa aaagattgaa tgtttcgact ctgttgaaat cagcggagtg gaggatcgct

     4981 tcaacgcatc cctgggaacg tatcacgatc tcctgaaaat cattaaagac aaggacttcc

     5041 tggacaatga ggagaacgag gacattcttg aggacattgt cctcaccctt acgttgtttg

     5101 aagataggga gatgattgaa gaacgcttga aaacttacgc tcatctcttc gacgacaaag

     5161 tcatgaaaca gctcaagagg cgccgatata caggatgggg gcggctgtca agaaaactga

     5221 tcaatgggat ccgagacaag cagagtggaa agacaatcct ggattttctt aagtccgatg

     5281 gatttgccaa ccggaacttc atgcagttga tccatgatga ctctctcacc tttaaggagg

     5341 acatccagaa agcacaagtt tctggccagg gggacagtct tcacgagcac atcgctaatc

     5401 ttgcaggtag cccagctatc aaaaagggaa tactgcagac cgttaaggtc gtggatgaac

     5461 tcgtcaaagt aatgggaagg cataagcccg agaatatcgt tatcgagatg gcccgagaga

     5521 accaaactac ccagaaggga cagaagaaca gtagggaaag gatgaagagg attgaagagg

     5581 gtataaaaga actggggtcc caaatcctta aggaacaccc agttgaaaac acccagcttc

     5641 agaatgagaa gctctacctg tactacctgc agaacggcag ggacatgtac gtggatcagg

     5701 aactggacat caatcggctc tccgactacg acgtggatca tatcgtgccc cagtcttttc

     5761 tcaaagatga ttctattgat aataaagtgt tgacaagatc cgataaaaat agagggaaga

     5821 gtgataacgt cccctcagaa gaagttgtca agaaaatgaa aaattattgg cggcagctgc

     5881 tgaacgccaa actgatcaca caacggaagt tcgataatct gactaaggct gaacgaggtg

     5941 gcctgtctga gttggataaa gccggcttca tcaaaaggca gcttgttgag acacgccaga

     6001 tcaccaagca cgtggcccaa attctcgatt cacgcatgaa caccaagtac gatgaaaatg

     6061 acaaactgat tcgagaggtg aaagttatta ctctgaagtc taagctggtc tcagatttca

     6121 gaaaggactt tcagttttat aaggtgagag agatcaacaa ttaccaccat gcgcatgatg

     6181 cctacctgaa tgcagtggta ggcactgcac ttatcaaaaa atatcccaag cttgaatctg

     6241 aatttgttta cggagactat aaagtgtacg atgttaggaa aatgatcgca aagtctgagc

     6301 aggaaatagg caaggccacc gctaagtact tcttttacag caatattatg aattttttca

     6361 agaccgagat tacactggcc aatggagaga ttcggaagcg accacttatc gaaacaaacg

     6421 gagaaacagg agaaatcgtg tgggacaagg gtagggattt cgcgacagtc cggaaggtcc

     6481 tgtccatgcc gcaggtgaac atcgttaaaa agaccgaagt acagaccgga ggcttctcca

     6541 aggaaagtat cctcccgaaa aggaacagcg acaagctgat cgcacgcaaa aaagattggg

     6601 accccaagaa atacggcgga ttcgattctc ctacagtcgc ttacagtgta ctggttgtgg

     6661 ccaaagtgga gaaagggaag tctaaaaaac tcaaaagcgt caaggaactg ctgggcatca

     6721 caatcatgga gcgatcaagc ttcgaaaaaa accccatcga ctttctcgag gcgaaaggat

     6781 ataaagaggt caaaaaagac ctcatcatta agcttcccaa gtactctctc tttgagcttg

     6841 aaaacggccg gaaacgaatg ctcgctagtg cgggcgagct gcagaaaggt aacgagctgg

     6901 cactgccctc taaatacgtt aatttcttgt atctggccag ccactatgaa aagctcaaag

     6961 ggtctcccga agataatgag cagaagcagc tgttcgtgga acaacacaaa cactaccttg

     7021 atgagatcat cgagcaaata agcgaattct ccaaaagagt gatcctcgcc gacgctaacc

     7081 tcgataaggt gctttctgct tacaataagc acagggataa gcccatcagg gagcaggcag

     7141 aaaacattat ccacttgttt actctgacca acttgggcgc gcctgcagcc ttcaagtact

     7201 tcgacaccac catagacaga aagcggtaca cctctacaaa ggaggtcctg gacgccacac

     7261 tgattcatca gtcaattacg gggctctatg aaacaagaat cgacctctct cagctcggtg

     7321 gagacagcag ggctgacccc aagaagaaga ggaaggtgtg atctcttctc gagtcatgta

     7381 attagttatg tcacgcttac attcacgccc tccccccaca tccgctctaa ccgaaaagga

     7441 aggagttaga caacctgaag tctaggtccc tatttatttt tttatagtta tgttagtatt

     7501 aagaacgtta tttatatttc aaatttttct tttttttctg tacagacgcg tgtacgcatg

     7561 taacattata ctgaaaacct tgcttgagaa ggttttggga cgctcgaagg ctttaatttg

     7621 cggccggtac ccaattcgcc ctatagtgag tcgtattacg cgcgctcact ggccgtcgtt

     7681 ttacaacgtc gtgactggga aaaccctggc gttacccaac ttaatcgcct tgcagcacat

     7741 ccccctttcg ccagctggcg taatagcgaa gaggcccgca ccgatcgccc ttcccaacag

     7801 ttgcgcagcc tgaatggcga atggcgcgac gcgccctgta gcggcgcatt aagcgcggcg

     7861 ggtgtggtgg ttacgcgcag cgtgaccgct acacttgcca gcgccctagc gcccgctcct

     7921 ttcgctttct tcccttcctt tctcgccacg ttcgccggct ttccccgtca agctctaaat

     7981 cgggggctcc ctttagggtt ccgatttagt gctttacggc acctcgaccc caaaaaactt

     8041 gattagggtg atggttcacg tagtgggcca tcgccctgat agacggtttt tcgccctttg

     8101 acgttggagt ccacgttctt taatagtgga ctcttgttcc aaactggaac aacactcaac

     8161 cctatctcgg tctattcttt tgatttataa gggattttgc cgatttcggc ctattggtta

     8221 aaaaatgagc tgatttaaca aaaatttaac gcgaatttta acaaaatatt aacgtttaca

     8281 atttcctgat gcggtatttt ctccttacgc atctgtgcgg tatttcacac cgcataggca

     8341 agtgcacaaa caatacttaa ataaatacta ctcagtaata acctatttct tagcattttt

     8401 gacgaaattt gctattttgt tagagtcttt tacaccattt gtctccacac ctccgcttac

     8461 atcaacacca ataacgccat ttaatctaag cgcatcacca acattttctg gcgtcagtcc

     8521 accagctaac ataaaatgta agctttcggg gctctcttgc cttccaaccc agtcagaaat

     8581 cgagttccaa tccaaaagtt cacctgtccc acctgcttct gaatcaaaca agggaataaa

     8641 cgaatgaggt ttctgtgaag ctgcactgag tagtatgttg cagtcttttg gaaatacgag

     8701 tcttttaata actggcaaac cgaggaactc ttggtattct tgccacgact catctccatg

     8761 cagttggacg atatcaatgc cgtaatcatt gaccagagcc aaaacatcct ccttaggttg

     8821 attacgaaac acgccaacca agtatttcgg agtgcctgaa ctatttttat atgcttttac

     8881 aagacttgaa attttccttg caataaccgg gtcaattgtt ctctttctat tgggcacaca

     8941 tataataccc agcaagtcag catcggaatc tagagcacat tctgcggcct ctgtgctctg

     9001 caagccgcaa actttcacca atggaccaga actacctgtg aaattaataa cagacatact

     9061 ccaagctgcc tttgtgtgct taatcacgta tactcacgtg ctcaatagtc accaatgccc

     9121 tccctcttgg ccctctcctt ttcttttttc gaccgaatta attcttaatc ggcaaaaaaa

     9181 gaaaagctcc ggatcaagat tgtacgtaag gtgacaagct atttttcaat aaagaatatc

     9241 ttccactact gccatctggc gtcataactg caaagtacac atatattacg atgctgtcta

     9301 ttaaatgctt cctatattat atatatagta atgtcgttta tggtgcactc tcagtacaat

     9361 ctgctctgat gccgcatagt taagccagcc ccgacacccg ccaacacccg ctgacgcgcc

     9421 ctgacgggct tgtctgctcc cggcatccgc ttacagacaa gctgtgaccg tctccgggag

     9481 ctgcatgtgt cagaggtttt caccgtcatc accgaaacgc gcga

//

 

Caution:
Product is for research use only!

No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart