pAAV- RC

$136.00

  • Model: PVT2103
  • 50 Units in Stock
Ask a question


Add to Cart:

pAAV-RC

PVT2103     2ug
 

 

pAAV-RC Information

Promoter: Lac
Replicator: pUC ori, F1 ori
Plasmid classification: virus series, adenovirus related packaging carrier
Plasmid size: 7327bp
Prokaryotic resistance: Amp
Cloned strain: Stbl3
Culture conditions: 37 centigrade, aerobic LB
Expression host: mammalian cells
Induction mode: no induction, instantaneous expression
5'sequencing primers: M13F:TGTAAAACGACGGCCAGT
3'sequencing primers: M13R:CAGGAAACAGCTATGACC

 

pAAV-RC Description

pAAV-RC plasmid contains the AAV-2 rep and cap genes, encoding replication proteins and viral capsid structural proteins, respectively. Establishing the proper expression levels of rep and cap gene products is an important step in achieving high-titer virus production. pAAV-RC directs Rep and Cap expression from two different promoters, achieving optimal expression levels for each set of gene products.

pAAV-RC-polyclonal-site

 

pAAV-RC Sequence

LOCUS       Exported                7327 bp ds-DNA     circular SYN 15-AUG-2018

DEFINITION  synthetic circular DNA

KEYWORDS    pAAV-RC2

SOURCE      synthetic DNA construct

  ORGANISM  synthetic DNA construct

REFERENCE   1  (bases 1 to 7327)

  TITLE     Direct Submission

FEATURES             Location/Qualifiers

     source          1..7327

                     /organism="synthetic DNA construct"

                     /mol_type="other DNA"

     CDS             131..1996

                     /codon_start=1

                     /note="AAV-2 rep"

                     /translation="MPGFYEIVIKVPSDLDEHLPGISDSFVNWVAEKEWELPPDSDMDL

                     NLIEQAPLTVAEKLQRDFLTEWRRVSKAPEALFFVQFEKGESYFHMHVLVETTGVKSMV

                     LGRFLSQIREKLIQRIYRGIEPTLPNWFAVTKTRNGAGGGNKVVDECYIPNYLLPKTQP

                     ELQWAWTNMEQYLSACLNLTERKRLVAQHLTHVSQTQEQNKENQNPNSDAPVIRSKTSA

                     RYMELVGWLVDKGITSEKQWIQEDQASYISFNAASNSRSQIKAALDNAGKIMSLTKTAP

                     DYLVGQQPVEDISSNRIYKILELNGYDPQYAASVFLGWATKKFGKRNTIWLFGPATTGK

                     TNIAEAIAHTVPFYGCVNWTNENFPFNDCVDKMVIWWEEGKMTAKVVESAKAILGGSKV

                     RVDQKCKSSAQIDPTPVIVTSNTNMCAVIDGNSTTFEHQQPLQDRMFKFELTRRLDHDF

                     GKVTKQEVKDFFRWAKDHVVEVEHEFYVKKGGAKKRPAPSDADISEPKRVRESVAQPST

                     SDAEASINYADRYQNKCSRHVGMNLMLFPCRQCERMNQNSNICFTHGQKDCLECFPVSE

                     SQPVSVVKKAYQKLCYIHHIMGKVPDACTACDLVNVDLDDCIFEQ"

     CDS             2013..4220

                     /codon_start=1

                     /note="AAV-2 cap"

                     /translation="MAADGYLPDWLEDTLSEGIRQWWKLKPGPPPPKPAERHKDDSRGL

                     VLPGYKYLGPFNGLDKGEPVNEADAAALEHDKAYDRQLDSGDNPYLKYNHADAEFQERL

                     KEDTSFGGNLGRAVFQAKKRVLEPLGLVEEPVKTAPGKKRPVEHSPVEPDSSSGTGKAG

                     QQPARKRLNFGQTGDADSVPDPQPLGQPPAAPSGLGTNTMATGSGAPMADNNEGADGVG

                     NSSGNWHCDSTWMGDRVITTSTRTWALPTYNNHLYKQISSQSGASNDNHYFGYSTPWGY

                     FDFNRFHCHFSPRDWQRLINNNWGFRPKRLNFKLFNIQVKEVTQNDGTTTIANNLTSTV

                     QVFTDSEYQLPYVLGSAHQGCLPPFPADVFMVPQYGYLTLNNGSQAVGRSSFYCLEYFP

                     SQMLRTGNNFTFSYTFEDVPFHSSYAHSQSLDRLMNPLIDQYLYYLSRTNTPSGTTTQS

                     RLQFSQAGASDIRDQSRNWLPGPCYRQQRVSKTSADNNNSEYSWTGATKYHLNGRDSLV

                     NPGPAMASHKDDEEKFFPQSGVLIFGKQGSEKTNVDIEKVMITDEEEIRTTNPVATEQY

                     GSVSTNLQRGNRQAATADVNTQGVLPGMVWQDRDVYLQGPIWAKIPHTDGHFHPSPLMG

                     GFGLKHPPPQILIKNTPVPANPSTTFSAAKFASFITQYSTGQVSVEIEWELQKENSKRW

                     NPEIQYTSNYNKSVNVDFTVDTNGVYSEPRPIGTRYLTRNL"

     rep_origin      complement(4705..5160)

                     /direction=LEFT

                     /note="f1 ori"

                     /note="f1 bacteriophage origin of replication; arrow 

                     indicates direction of (+) strand synthesis"

     promoter        5187..5291

                     /gene="bla"

                     /note="AmpR promoter"

     CDS             5292..6152

                     /codon_start=1

                     /gene="bla"

                     /product="beta-lactamase"

                     /note="AmpR"

                     /note="confers resistance to ampicillin, carbenicillin, and

                     related antibiotics"

                     /translation="[TEM beta-lactamase fragment, 45 aa]

                     ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVEYS

                     [TEM beta-lactamase fragment, 59 aa]

                     EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA

                     [TEM beta-lactamase fragment, 59 aa]

                     LIKHW"

     rep_origin      6323..6911

                     /direction=RIGHT

                     /note="ori"

                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 

                     replication"

ORIGIN

        1 gcgcgccgat atcgttaacg ccccgcgccg gccgctctag aactagtgga tcccccggaa

       61 gatcagaagt tcctattccg aagttcctat tctctagaaa gtataggaac ttctgatctg

      121 cgcagccgcc atgccggggt tttacgagat tgtgattaag gtccccagcg accttgacga

      181 gcatctgccc ggcatttctg acagctttgt gaactgggtg gccgagaagg aatgggagtt

      241 gccgccagat tctgacatgg atctgaatct gattgagcag gcacccctga ccgtggccga

      301 gaagctgcag cgcgactttc tgacggaatg gcgccgtgtg agtaaggccc cggaggccct

      361 tttctttgtg caatttgaga agggagagag ctacttccac atgcacgtgc tcgtggaaac

      421 caccggggtg aaatccatgg ttttgggacg tttcctgagt cagattcgcg aaaaactgat

      481 tcagagaatt taccgcggga tcgagccgac tttgccaaac tggttcgcgg tcacaaagac

      541 cagaaatggc gccggaggcg ggaacaaggt ggtggatgag tgctacatcc ccaattactt

      601 gctccccaaa acccagcctg agctccagtg ggcgtggact aatatggaac agtatttaag

      661 cgcctgtttg aatctcacgg agcgtaaacg gttggtggcg cagcatctga cgcacgtgtc

      721 gcagacgcag gagcagaaca aagagaatca gaatcccaat tctgatgcgc cggtgatcag

      781 atcaaaaact tcagccaggt acatggagct ggtcgggtgg ctcgtggaca aggggattac

      841 ctcggagaag cagtggatcc aggaggacca ggcctcatac atctccttca atgcggcctc

      901 caactcgcgg tcccaaatca aggctgcctt ggacaatgcg ggaaagatta tgagcctgac

      961 taaaaccgcc cccgactacc tggtgggcca gcagcccgtg gaggacattt ccagcaatcg

     1021 gatttataaa attttggaac taaacgggta cgatccccaa tatgcggctt ccgtctttct

     1081 gggatgggcc acgaaaaagt tcggcaagag gaacaccatc tggctgtttg ggcctgcaac

     1141 taccgggaag accaacatcg cggaggccat agcccacact gtgcccttct acgggtgcgt

     1201 aaactggacc aatgagaact ttcccttcaa cgactgtgtc gacaagatgg tgatctggtg

     1261 ggaggagggg aagatgaccg ccaaggtcgt ggagtcggcc aaagccattc tcggaggaag

     1321 caaggtgcgc gtggaccaga aatgcaagtc ctcggcccag atagacccga ctcccgtgat

     1381 cgtcacctcc aacaccaaca tgtgcgccgt gattgacggg aactcaacga ccttcgaaca

     1441 ccagcagccg ttgcaagacc ggatgttcaa atttgaactc acccgccgtc tggatcatga

     1501 ctttgggaag gtcaccaagc aggaagtcaa agactttttc cggtgggcaa aggatcacgt

     1561 ggttgaggtg gagcatgaat tctacgtcaa aaagggtgga gccaagaaaa gacccgcccc

     1621 cagtgacgca gatataagtg agcccaaacg ggtgcgcgag tcagttgcgc agccatcgac

     1681 gtcagacgcg gaagcttcga tcaactacgc agacaggtac caaaacaaat gttctcgtca

     1741 cgtgggcatg aatctgatgc tgtttccctg cagacaatgc gagagaatga atcagaattc

     1801 aaatatctgc ttcactcacg gacagaaaga ctgtttagag tgctttcccg tgtcagaatc

     1861 tcaacccgtt tctgtcgtca aaaaggcgta tcagaaactg tgctacattc atcatatcat

     1921 gggaaaggtg ccagacgctt gcactgcctg cgatctggtc aatgtggatt tggatgactg

     1981 catctttgaa caataaatga tttaaatcag gtatggctgc cgatggttat cttccagatt

     2041 ggctcgagga cactctctct gaaggaataa gacagtggtg gaagctcaaa cctggcccac

     2101 caccaccaaa gcccgcagag cggcataagg acgacagcag gggtcttgtg cttcctgggt

     2161 acaagtacct cggacccttc aacggactcg acaagggaga gccggtcaac gaggcagacg

     2221 ccgcggccct cgagcacgac aaagcctacg accggcagct cgacagcgga gacaacccgt

     2281 acctcaagta caaccacgcc gacgcggagt ttcaggagcg ccttaaagaa gatacgtctt

     2341 ttgggggcaa cctcggacga gcagtcttcc aggcgaaaaa gagggttctt gaacctctgg

     2401 gcctggttga ggaacctgtt aagacggctc cgggaaaaaa gaggccggta gagcactctc

     2461 ctgtggagcc agactcctcc tcgggaaccg gaaaggcggg ccagcagcct gcaagaaaaa

     2521 gattgaattt tggtcagact ggagacgcag actcagtacc tgacccccag cctctcggac

     2581 agccaccagc agccccctct ggtctgggaa ctaatacgat ggctacaggc agtggcgcac

     2641 caatggcaga caataacgag ggcgccgacg gagtgggtaa ttcctcggga aattggcatt

     2701 gcgattccac atggatgggc gacagagtca tcaccaccag cacccgaacc tgggccctgc

     2761 ccacctacaa caaccacctc tacaaacaaa tttccagcca atcaggagcc tcgaacgaca

     2821 atcactactt tggctacagc accccttggg ggtattttga cttcaacaga ttccactgcc

     2881 acttttcacc acgtgactgg caaagactca tcaacaacaa ctggggattc cgacccaaga

     2941 gactcaactt caagctcttt aacattcaag tcaaagaggt cacgcagaat gacggtacga

     3001 cgacgattgc caataacctt accagcacgg ttcaggtgtt tactgactcg gagtaccagc

     3061 tcccgtacgt cctcggctcg gcgcatcaag gatgcctccc gccgttccca gcagacgtct

     3121 tcatggtgcc acagtatgga tacctcaccc tgaacaacgg gagtcaggca gtaggacgct

     3181 cttcatttta ctgcctggag tactttcctt ctcagatgct gcgtaccgga aacaacttta

     3241 ccttcagcta cacttttgag gacgttcctt tccacagcag ctacgctcac agccagagtc

     3301 tggaccgtct catgaatcct ctcatcgacc agtacctgta ttacttgagc agaacaaaca

     3361 ctccaagtgg aaccaccacg cagtcaaggc ttcagttttc tcaggccgga gcgagtgaca

     3421 ttcgggacca gtctaggaac tggcttcctg gaccctgtta ccgccagcag cgagtatcaa

     3481 agacatctgc ggataacaac aacagtgaat actcgtggac tggagctacc aagtaccacc

     3541 tcaatggcag agactctctg gtgaatccgg gcccggccat ggcaagccac aaggacgatg

     3601 aagaaaagtt ttttcctcag agcggggttc tcatctttgg gaagcaaggc tcagagaaaa

     3661 caaatgtgga cattgaaaag gtcatgatta cagacgaaga ggaaatcagg acaaccaatc

     3721 ccgtggctac ggagcagtat ggttctgtat ctaccaacct ccagagaggc aacagacaag

     3781 cagctaccgc agatgtcaac acacaaggcg ttcttccagg catggtctgg caggacagag

     3841 atgtgtacct tcaggggccc atctgggcaa agattccaca cacggacgga cattttcacc

     3901 cctctcccct catgggtgga ttcggactta aacaccctcc tccacagatt ctcatcaaga

     3961 acaccccggt acctgcgaat ccttcgacca ccttcagtgc ggcaaagttt gcttccttca

     4021 tcacacagta ctccacggga caggtcagcg tggagatcga gtgggagctg cagaaggaaa

     4081 acagcaaacg ctggaatccc gaaattcagt acacttccaa ctacaacaag tctgttaatg

     4141 tggactttac tgtggacact aatggcgtgt attcagagcc tcgccccatt ggcaccagat

     4201 acctgactcg taatctgtaa ttgcttgtta atcaataaac cgtttaattc gtttcagttg

     4261 aactttggtc tctgcgtatt tctttcttat ctagtttcca tggctacgta gataagtagc

     4321 atggcgggtt aatcattaac tacagcccgg gcgtttaaac agcgggcgga ggggtggagt

     4381 cgtgacgtga attacgtcat agggttaggg aggtcctgta ttagaggtca cgtgagtgtt

     4441 ttgcgacatt ttgcgacacc atgtggtctc gctggggggg ggggcccgag tgagcacgca

     4501 gggtctccat tttgaagcgg gaggtttgaa cgagcgctgg cgcgctcact ggccgtcgtt

     4561 ttacaacgtc gtgactggga aaaccctggc gttacccaac ttaatcgcct tgcagcacat

     4621 ccccctttcg ccagctggcg taatagcgaa gaggcccgca ccgatcgccc ttcccaacag

     4681 ttgcgcagcc tgaatggcga atggaaattg taagcgttaa tattttgtta aaattcgcgt

     4741 taaatttttg ttaaatcagc tcattttttt aaccaatagg ccgaaatcgg caaaatccct

     4801 tataaatcaa aagaatagac cgagataggg ttgagtgttg ttccagtttg gaacaagagt

     4861 ccactattaa gaacgtggac tccaacgtca aagggcgaaa aaccgtctat cagggcgatg

     4921 gcccactacg tgaaccatca ccctaatcaa gttttttggg gtcgaggtgc cgtaaagcac

     4981 taaatcggaa ccctaaaggg agcccccgat ttagagcttg acggggaaag ccggcgaacg

     5041 tggcgagaaa ggaagggaag aaagcgaaag gagcgggcgc tagggcgctg gcaagtgtag

     5101 cggtcacgct gcgcgtaacc accacacccg ccgcgcttaa tgcgccgcta cagggcgcgt

     5161 caggtggcac ttttcgggga aatgtgcgcg gaacccctat ttgtttattt ttctaaatac

     5221 attcaaatat gtatccgctc atgagacaat aaccctgata aatgcttcaa taatattgaa

     5281 aaaggaagag tatgagtatt caacatttcc gtgtcgccct tattcccttt tttgcggcat

     5341 tttgccttcc tgtttttgct cacccagaaa cgctggtgaa agtaaaagat gctgaagatc

     5401 agttgggtgc acgagtgggt tacatcgaac tggatctcaa cagcggtaag atccttgaga

     5461 gttttcgccc cgaagaacgt tttccaatga tgagcacttt taaagttctg ctatgtggcg

     5521 cggtattatc ccgtattgac gccgggcaag agcaactcgg tcgccgcata cactattctc

     5581 agaatgactt ggttgagtac tcaccagtca cagaaaagca tcttacggat ggcatgacag

     5641 taagagaatt atgcagtgct gccataacca tgagtgataa cactgcggcc aacttacttc

     5701 tgacaacgat cggaggaccg aaggagctaa ccgctttttt gcacaacatg ggggatcatg

     5761 taactcgcct tgatcgttgg gaaccggagc tgaatgaagc cataccaaac gacgagcgtg

     5821 acaccacgat gcctgtagca atggcaacaa cgttgcgcaa actattaact ggcgaactac

     5881 ttactctagc ttcccggcaa caattaatag actggatgga ggcggataaa gttgcaggac

     5941 cacttctgcg ctcggccctt ccggctggct ggtttattgc tgataaatct ggagccggtg

     6001 agcgtgggtc tcgcggtatc attgcagcac tggggccaga tggtaagccc tcccgtatcg

     6061 tagttatcta cacgacgggg agtcaggcaa ctatggatga acgaaataga cagatcgctg

     6121 agataggtgc ctcactgatt aagcattggt aactgtcaga ccaagtttac tcatatatac

     6181 tttagattga tttaaaactt catttttaat ttaaaaggat ctaggtgaag atcctttttg

     6241 ataatctcat gaccaaaatc ccttaacgtg agttttcgtt ccactgagcg tcagaccccg

     6301 tagaaaagat caaaggatct tcttgagatc ctttttttct gcgcgtaatc tgctgcttgc

     6361 aaacaaaaaa accaccgcta ccagcggtgg tttgtttgcc ggatcaagag ctaccaactc

     6421 tttttccgaa ggtaactggc ttcagcagag cgcagatacc aaatactgtt cttctagtgt

     6481 agccgtagtt aggccaccac ttcaagaact ctgtagcacc gcctacatac ctcgctctgc

     6541 taatcctgtt accagtggct gctgccagtg gcgataagtc gtgtcttacc gggttggact

     6601 caagacgata gttaccggat aaggcgcagc ggtcgggctg aacggggggt tcgtgcacac

     6661 agcccagctt ggagcgaacg acctacaccg aactgagata cctacagcgt gagctatgag

     6721 aaagcgccac gcttcccgaa gggagaaagg cggacaggta tccggtaagc ggcagggtcg

     6781 gaacaggaga gcgcacgagg gagcttccag ggggaaacgc ctggtatctt tatagtcctg

     6841 tcgggtttcg ccacctctga cttgagcgtc gatttttgtg atgctcgtca ggggggcgga

     6901 gcctatggaa aaacgccagc aacgcggcct ttttacggtt cctggccttt tgctggcctt

     6961 ttgctcacat gttctttcct gcgttatccc ctgattctgt ggataaccgt attaccgcct

     7021 ttgagtgagc tgataccgct cgccgcagcc gaacgaccga gcgcagcgag tcagtgagcg

     7081 aggaagcgga agagcgccca atacgcaaac cgcctctccc cgcgcgttgg ccgattcatt

     7141 aatgcagctg gcacgacagg tttcccgact ggaaagcggg cagtgagcgc aacgcaatta

     7201 atgtgagtta gctcactcat taggcacccc aggctttaca ctttatgctt ccggctcgta

     7261 tgttgtgtgg aattgtgagc ggataacaat ttcacacagg aaacagctat gaccatgatt

     7321 acgccaa

//


Caution:
Product is for research use only!

 

Search name

pAAV-RC,Plasmid pAAV-RC,pAAV-RC vector

No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart