pAAV2-8

$193.00

  • Model: PVT11048
  • 50 Units in Stock
Ask a question


Add to Cart:

pAAV2-8

Catalog No. PVT11048
Packing 2ug

 

pAAV2-8 Information

Prokaryotic resistance: ampicillin Amp

Cloned strain: Escherichia coli Stbl3

Culture conditions: 37 degrees centigrade

 

pAAV2-8 Sequence
 

LOCUS       Exported               21837 bp ds-DNA     circular SYN 04-DEC-2017

DEFINITION  synthetic circular DNA

FEATURES             Location/Qualifiers

     source          1..21837

                     /organism="synthetic DNA construct"

                     /mol_type="other DNA"

     repeat_region   21..123

                     /label=ITR

                     /note="inverted terminal repeat of human adenovirus 

                     serotype 5"

     misc_signal     211..361

                     /label=Ad5 Psi

                     /note="packaging signal for adenovirus serotype 5"

     CDS             1346..3211

                     /codon_start=1

                     /label=Rep

                     /translation="MPGFYEIVIKVPSDLDGHLPGISDSFVNWVAEKEWELPPDSDMDL

                     NLIEQAPLTVAEKLQRDFLTEWRRVSKAPEALFFVQFEKGESYFHMHVLVETTGVKSMV

                     LGRFLSQIREKLIQRIYRGIEPTLPNWFAVTKTRNGAGGGNKVVDECYIPNYLLPKTQP

                     ELQWAWTNMEQYLSACLNLTERKRLVAQHLTHVSQTQEQNKENQNPNSDAPVIRSKTSA

                     RYMELVGWLVDKGITSEKQWIQEDQASYISFNAASNSRSQIKAALDNAGKIMSLTKTAP

                     DYLVGQQPVEDISSNRIYKILELNGYDPQYAASVFLGWATKKFGKRNTIWLFGPATTGK

                     TNIAEAIAHTVPFYGCVNWTNENFPFNDCVDKMVIWWEEGKMTAKVVESAKAILGGSKV

                     RVDQKCKSSAQIDPTPVIVTSNTNMCAVIDGNSTTFEHQQPLQDRMFKFELTRRLDHDF

                     GKVTKQEVKDFFRWAKDHVVEVEHEFYVKKGGAKKRPAPSDADISEPKRVRESVAQPST

                     SDAEASINYADRYQNKCSRHVGMNLMLFPCRQCERMNQNSNICFTHGQKDCLECFPVSE

                     SQPVSVVKKAYQKLCYIHHIMGKVPDACTACDLVNVDLDDCIFEQ"

     CDS             3228..5135

                     /codon_start=1

                     /label=Cap

                     /translation="MAADGYLPDWLEDNLSEGIREWWALKPGAPKPKANQQKQDDGRGL

                     VLPGYKYLGPFNGLDKGEPVNAADAAALEHDKAYDQQLQAGDNPYLRYNHADAEFQERL

                     QEDTSFGGNLGRAVFQAKKRVLEPLGLVEEGAKTAPGKKRPVEPSPQRSPDSSTGIGKK

                     GQQPARKRLNFGQTGDSESVPDPQPLGEPPAAPSGVGPNTMAAGGGAPMADNNEGADGV

                     GSSSGNWHCDSTWLGDRVITTSTRTWALPTYNNHLYKQISNGTSGGATNDNTYFGYSTP

                     WGYFDFNRFHCHFSPRDWQRLINNNWGFRPKRLSFKLFNIQVKEVTQNEGTKTIANNLT

                     STIQVFTDSEYQLPYVLGSAHQGCLPPFPADVFMIPQYGYLTLNNGSQAVGRSSFYCLE

                     YFPSQMLRTGNNFQFTYTFEDVPFHSSYAHSQSLDRLMNPLIDQYLYYLSRTQTTGGTA

                     NTQTLGFSQGGPNTMANQAKNWLPGPCYRQQRVSTTTGQNNNSNFAWTAGTKYHLNGRN

                     SLANPGIAMATHKDDEERFFPSNGILILANKMLPETMRITAMSCSPA?KKSKPLTLWLQ

                     RNTVSWQITCSSKTRLLKLELSTARGPYPVWSGRTGTCTCRVPSGPRFLTRTATSTRLR

                     "

     repeat_region   19739..19841

                     /label=ITR

                     /note="inverted terminal repeat of human adenovirus 

                     serotype 5"

     rep_origin      complement(20032..20620)

                     /direction=LEFT

                     /label=ori

                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 

                     replication"

     CDS             complement(20772..21632)

                     /codon_start=1

                     /gene="bla"

                     /product="beta-lactamase"

                     /label=AmpR

                     /note="confers resistance to ampicillin, carbenicillin, and

                     related antibiotics"

                     /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI

                     ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS

                     PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW

                     EPELNEAIPNDERDTTMPATMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA

                     LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS

                     LIKHW"

     promoter        complement(21633..21737)

                     /gene="bla"

                     /label=AmpR promoter

ORIGIN

        1 ggatccgaat tcttaattaa catcatcaat aatatacctt attttggatt gaagccaata

       61 tgataatgag ggggtggagt ttgtgacgtg gcgcggggcg tgggaacggg gcgggtgacg

      121 tagtagtgtg gcggaagtgt gatgttgcaa gtgtggcgga acacatgtaa gcgacggatg

      181 tggcaaaagt gacgtttttg gtgtgcgccg gtgtacacag gaagtgacaa ttttcgcgcg

      241 gttttaggcg gatgttgtag taaatttggg cgtaaccgag taagatttgg ccattttcgc

      301 gggaaaactg aataagagga agtgaaatct gaataatttt gtgttactca tagcgcgtaa

      361 tatttgtcta gggccgcggg gactttgacc gtttacgtgg agactcgccc aggtgttttt

      421 ctcaggtgtt ttccgcgttc cgggtcaaag ttggcgtttt attattatag tcagggggat

      481 cctctagaac tagtggatcc gtccctcagg cctagaagta aaaaagggaa aaaagagtgt

      541 gtttgtcaaa ataggagaca ggtggtggca accaaggact tataggggac cttacatcta

      601 cagaccaaca gatgccccct taccatatac aggaagatat gacttaaatt gggataggtg

      661 ggtcacaatc aacggctata aagtgttata cagatccctc ccctcccctt tcgtgaaaga

      721 ctcgccagag ctagacctcc ttggtgtatg ctaactgaga agagaaagac gacatgaaac

      781 aacaggtaca tgattatatt tatctaggaa caggaatgca cttttgggga aaggttttcc

      841 ataccaagga aggggcagtg gctggactga tagaacatta ttctgcaaaa acttatggta

      901 tgagttatta tgattagcct ttatttgccc aaccttgcgg ttcccagggt ttaaataagt

      961 ttatggttac aaactgttct taaaacgagg atgtgagaca agtggtttcc tgacttggtt

     1021 tggtaatcaa atgttctgat ctgagctctt agtgttctat tttcctatgt tcttttggaa

     1081 tctatccaag tcttatgtaa atgcttatgt aaaccataat ataaaagagt gctgattttt

     1141 tgagtaaact tgcaacagtc ctaacattct tctctcgtgt gtttgtgtct gttcgccatc

     1201 ccgtctccgc tcgtcactta tccttcactt ttcagagggt ccccccgcag atcccggtca

     1261 ccctcaggtc gggacctgca gaagacgccc gagtgagcac gcagggtctc cattttgaag

     1321 cgggaggttt gaacgcgcag ccgccatgcc ggggttttac gagattgtga ttaaggtccc

     1381 cagcgacctt gacgggcatc tgcccggcat ttctgacagc tttgtgaact gggtggccga

     1441 gaaggaatgg gagttgccgc cagattctga catggatctg aatctgattg agcaggcacc

     1501 cctgaccgtg gccgagaagc tgcagcgcga ctttctgacg gaatggcgcc gtgtgagtaa

     1561 ggccccggag gcccttttct ttgtgcaatt tgagaaggga gagagctact tccacatgca

     1621 cgtgctcgtg gaaaccaccg gggtgaaatc catggttttg ggacgtttcc tgagtcagat

     1681 tcgcgaaaaa ctgattcaga gaatttaccg cgggatcgag ccgactttgc caaactggtt

     1741 cgcggtcaca aagaccagaa atggcgccgg aggcgggaac aaggtggtgg atgagtgcta

     1801 catccccaat tacttgctcc ccaaaaccca gcctgagctc cagtgggcgt ggactaatat

     1861 ggaacagtat ttaagcgcct gtttgaatct cacggagcgt aaacggttgg tggcgcagca

     1921 tctgacgcac gtgtcgcaga cgcaggagca gaacaaagag aatcagaatc ccaattctga

     1981 tgcgccggtg atcagatcaa aaacttcagc caggtacatg gagctggtcg ggtggctcgt

     2041 ggacaagggg attacctcgg agaagcagtg gatccaggag gaccaggcct catacatctc

     2101 cttcaatgcg gcctccaact cgcggtccca aatcaaggct gccttggaca atgcgggaaa

     2161 gattatgagc ctgactaaaa ccgcccccga ctacctggtg ggccagcagc ccgtggagga

     2221 catttccagc aatcggattt ataaaatttt ggaactaaac gggtacgatc cccaatatgc

     2281 ggcttccgtc tttctgggat gggccacgaa aaagttcggc aagaggaaca ccatctggct

     2341 gtttgggcct gcaactaccg ggaagaccaa catcgcggag gccatagccc acactgtgcc

     2401 cttctacggg tgcgtaaact ggaccaatga gaactttccc ttcaacgact gtgtcgacaa

     2461 gatggtgatc tggtgggagg aggggaagat gaccgccaag gtcgtggagt cggccaaagc

     2521 cattctcgga ggaagcaagg tgcgcgtgga ccagaaatgc aagtcctcgg cccagataga

     2581 cccgactccc gtgatcgtca cctccaacac caacatgtgc gccgtgattg acgggaactc

     2641 aacgaccttc gaacaccagc agccgttgca agaccggatg ttcaaatttg aactcacccg

     2701 ccgtctggat catgactttg ggaaggtcac caagcaggaa gtcaaagact ttttccggtg

     2761 ggcaaaggat cacgtggttg aggtggagca tgaattctac gtcaaaaagg gtggagccaa

     2821 gaaaagaccc gcccccagtg acgcagatat aagtgagccc aaacgggtgc gcgagtcagt

     2881 tgcgcagcca tcgacgtcag acgcggaagc ttcgatcaac tacgcagaca ggtaccaaaa

     2941 caaatgttct cgtcacgtgg gcatgaatct gatgctgttt ccctgcagac aatgcgagag

     3001 aatgaatcag aattcaaata tctgcttcac tcacggacag aaagactgtt tagagtgctt

     3061 tcccgtgtca gaatctcaac ccgtttctgt cgtcaaaaag gcgtatcaga aactgtgcta

     3121 cattcatcat atcatgggaa aggtgccaga cgcttgcact gcctgcgatc tggtcaatgt

     3181 ggatttggat gactgcatct ttgaacaata aatgatttaa atcaggtatg gctgccgatg

     3241 gttatcttcc agattggctc gaggacaacc tctctgaggg cattcgcgag tggtgggcgc

     3301 tgaaacctgg agccccgaag cccaaagcca accagcaaaa gcaggacgac ggccggggtc

     3361 tggtgcttcc tggctacaag tacctcggac ccttcaacgg actcgacaag ggggagcccg

     3421 tcaacgcggc ggacgcagcg gccctcgagc acgacaaggc ctacgaccag cagctgcagg

     3481 cgggtgacaa tccgtacctg cggtataacc acgccgacgc cgagtttcag gagcgtctgc

     3541 aagaagatac gtcttttggg ggcaacctcg ggcgagcagt cttccaggcc aagaagcggg

     3601 ttctcgaacc tctcggtctg gttgaggaag gcgctaagac ggctcctgga aagaagagac

     3661 cggtagagcc atcaccccag cgttctccag actcctctac gggcatcggc aagaaaggcc

     3721 aacagcccgc cagaaaaaga ctcaattttg gtcagactgg cgactcagag tcagttccag

     3781 accctcaacc tctcggagaa cctccagcag cgccctctgg tgtgggacct aatacaatgg

     3841 ctgcaggcgg tggcgcacca atggcagaca ataacgaagg cgccgacgga gtgggtagtt

     3901 cctcgggaaa ttggcattgc gattccacat ggctgggcga cagagtcatc accaccagca

     3961 cccgaacctg ggccctgccc acctacaaca accacctcta caagcaaatc tccaacggga

     4021 catcgggagg agccaccaac gacaacacct acttcggcta cagcaccccc tgggggtatt

     4081 ttgactttaa cagattccac tgccactttt caccacgtga ctggcagcga ctcatcaaca

     4141 acaactgggg attccggccc aagagactca gcttcaagct cttcaacatc caggtcaagg

     4201 aggtcacgca gaatgaaggc accaagacca tcgccaataa cctcaccagc accatccagg

     4261 tgtttacgga ctcggagtac cagctgccgt acgttctcgg ctctgcccac cagggctgcc

     4321 tgcctccgtt cccggcggac gtgttcatga ttccccagta cggctaccta acactcaaca

     4381 acggtagtca ggccgtggga cgctcctcct tctactgcct ggaatacttt ccttcgcaga

     4441 tgctgagaac cggcaacaac ttccagttta cttacacctt cgaggacgtg cctttccaca

     4501 gcagctacgc ccacagccag agcttggacc ggctgatgaa tcctctgatt gaccagtacc

     4561 tgtactactt gtctcggact caaacaacag gaggcacggc aaatacgcag actctgggct

     4621 tcagccaagg tgggcctaat acaatggcca atcaggcaaa gaactggctg ccaggaccct

     4681 gttaccgcca acaacgcgtc tcaacgacaa ccgggcaaaa caacaatagc aactttgcct

     4741 ggactgctgg gaccaaatac catctgaatg gaagaaattc attggctaat cctggcatcg

     4801 ctatggcaac acacaaagac gacgaggagc gtttttttcc cagtaacggg atcctgattt

     4861 tggcaaacaa aatgctgcca gagacaatgc ggattacagc gatgtcatgc tcaccagcga

     4921 gnaagaaatc aaaaccacta accctgtggc tacagaggaa tacggtatcg tggcagataa

     4981 cttgcagcag caaaacacgg ctcctcaaat tggaactgtc aacagccagg gggccttacc

     5041 cggtatggtc tggcagaacc gggacgtgta cctgcagggt cccatctggg ccaagattcc

     5101 tcacacggac ggcaacttcc acccgtctcc gctgatgggc ggctttggcc tgaaacatcc

     5161 tccgcctcag atcctgatca agaacacgcc tgtacctgcg gatcctccga ccaccttcaa

     5221 ccagtcaaag ctgaactctt tcatcacgca atacagcacc ggacaggtca gcgtggaaat

     5281 tgaatgggag ctgcagaagg aaaacagcaa gcgctggaac cccgagatcc agtacacctc

     5341 caactactac aaatctacaa gtgtggactt tgctgttaat acagaaggcg tgtactctga

     5401 accccgcccc attggcaccc gttacctcac ccgtaatctg taattgcctg ttaatcaata

     5461 aaccggttga ttcgtttcag ttgaactttg gtctctgcga agggcgaatt cgtttccatc

     5521 gatgcatgtc cttgggtccg gcctgctgaa tgcgcaggcg gtcggccatg ccccaggctt

     5581 cgttttgaca tcggcgcagg tctttgtagt agtcttgcat gagcctttct accggcactt

     5641 cttcttctcc ttcctcttgt cctgcatctc ttgcatctat cgctgcggcg gcggcggagt

     5701 ttggccgtag gtggcgccct cttcctccca tgcgtgtgac cccgaagccc ctcatcggct

     5761 gaagcagggc taggtcggcg acaacgcgct cggctaatat ggcctgctgc acctgcgtga

     5821 gggtagactg gaagtcatcc atgtccacaa agcggtggta tgcgcccgtg ttgatggtgt

     5881 aagtgcagtt ggccataacg gaccagttaa cggtctggtg acccggctgc gagagctcgg

     5941 tgtacctgag acgcgagtaa gccctcgagt caaatacgta gtcgttgcaa gtccgcacca

     6001 ggtactggta tcccaccaaa aagtgcggcg gcggctggcg gtagaggggc cagcgtaggg

     6061 tggccggggc tccgggggcg agatcttcca acataaggcg atgatatccg tagatgtacc

     6121 tggacatcca ggtgatgccg gcggcggtgg tggaggcgcg cggaaagtcg cggacgcggt

     6181 tccagatgtt gcgcagcggc aaaaagtgct ccatggtcgg gacgctctgg ccggtcaggc

     6241 gcgcgcaatc gttgacgctc tagaccgtgc aaaaggagag cctgtaagcg ggcactcttc

     6301 cgtggtctgg tggataaatt cgcaagggta tcatggcgga cgaccggggt tcgagccccg

     6361 tatccggccg tccgccgtga tccatgcggt taccgcccgc gtgtcgaacc caggtgtgcg

     6421 acgtcagaca acgggggagt gctccttttg gcttccttcc aggcgcggcg gctgctgcgc

     6481 tagctttttt ggccactggc cgcgcgcagc gtaagcggtt aggctggaaa gcgaaagcat

     6541 taagtggctc gctccctgta gccggagggt tattttccaa gggttgagtc gcgggacccc

     6601 cggttcgagt ctcggaccgg ccggactgcg gcgaacgggg gtttgcctcc ccgtcatgca

     6661 agaccccgct tgcaaattcc tccggaaaca gggacgagcc ccttttttgc ttttcccaga

     6721 tgcatccggt gctgcggcag atgcgccccc ctcctcagca gcggcaagag caagagcagc

     6781 ggcagacatg cagggcaccc tcccctcctc ctaccgcgtc aggaggggcg acatccgcgg

     6841 ttgacgcggc agcagatggt gattacgaac ccccgcggcg ccgggcccgg cactacctgg

     6901 acttggagga gggcgagggc ctggcgcggc taggagcgcc ctctcctgag cggtacccaa

     6961 gggtgcagct gaagcgtgat acgcgtgagg cgtacgtgcc gcggcagaac ctgtttcgcg

     7021 accgcgaggg agaggagccc gaggagatgc gggatcgaaa gttccacgca gggcgcgagc

     7081 tgcggcatgg cctgaatcgc gagcggttgc tgcgcgagga ggactttgag cccgacgcgc

     7141 gaaccgggat tagtcccgcg cgcgcacacg tggcggccgc cgacctggta accgcatacg

     7201 agcagacggt gaaccagggc gatcgcaccc tttggcgcat cccattctcc agtaacttta

     7261 tgtccatggg cgcactcaca gacctgggcc aaaaccttct ctacgccaac tccgcccacg

     7321 cgctagacat gacttttgag gtggatccca tggacgagcc cacccttctt tatgttttgt

     7381 ttgaagtctt tgacgtggtc cgtgtgcacc ggccgcaccg cggcgtcatc gaaaccgtgt

     7441 acctgcgcac gcccttctcg gccggcaacg ccacaacata aagaagcaag caacatcaac

     7501 aacagctgcc gccatgggct ccagtgagca ggaactgaaa gccattgtca aagatcttgg

     7561 ttgtgggcca tattttttgg gcacctatga caagcgcttt ccaggctttg tttctccaca

     7621 caagctcgcc tgcgccatag tcaatacggc cggtcgcgag actgggggcg tacactggat

     7681 ggcctttgcc tggaacccgc actcaaaaac atgctacctc tttgagccct ttggcttttc

     7741 tgaccagcga ctcaagcagg tttaccagtt tgagtacgag tcactcctgc gccgtagcgc

     7801 cattgcttct tcccccgacc gctgtataac gctggaaaag tccacccaaa gcgtacaggg

     7861 gcccaactcg gccgcctgtg gactattctg ctgcatgttt ctccacgcct ttgccaactg

     7921 gccccaaact cccatggatc acaaccccac catgaacctt attaccgggg tacccaactc

     7981 catgctcaac agtccccagg tacagcccac cctgcgtcgc aaccaggaac agctctacag

     8041 cttcctggag cgccactcgc cctacttccg cagccacagt gcgcagatta ggagcgccac

     8101 ttctttttgt cacttgaaaa acatgtaaaa ataatgtact agagacactt tcaataaagg

     8161 caaatgcttt tatttgtaca ctctcgggtg attatttacc cccacccttg ccgtctgcgc

     8221 cgtttaaaaa tcaaaggggt tctgccgcgc atcgctatgc gccactggca gggacacgtt

     8281 gcgatactgg tgtttagtgc tccacttaaa ctcaggcaca accatccgcg gcagctcggt

     8341 gaagttttca ctccacaggc tgcgcaccat caccaacgcg tttagcaggt cgggcgccga

     8401 tatcttgaag tcgcagttgg ggcctccgcc ctgcgcgcgc gagttgcgat acacagggtt

     8461 gcagcactgg aacactatca gcgccgggtg gtgcacgctg gccagcacgc tcttgtcgga

     8521 gatcagatcc gcgtccaggt cctccgcgtt gctcagggcg aacggagtca actttggtag

     8581 ctgccttccc aaaaagggcg cgtgcccagg ctttgagttg cactcgcacc gtagtggcat

     8641 caaaaggtga ccgtgcccgg tctgggcgtt aggatacagc gcctgcataa aagccttgat

     8701 ctgcttaaaa gccacctgag cctttgcgcc ttcagagaag aacatgccgc aagacttgcc

     8761 ggaaaactga ttggccggac aggccgcgtc gtgcacgcag caccttgcgt cggtgttgga

     8821 gatctgcacc acatttcggc cccaccggtt cttcacgatc ttggccttgc tagactgctc

     8881 cttcagcgcg cgctgcccgt tttcgctcgt cacatccatt tcaatcacgt gctccttatt

     8941 tatcataatg cttccgtgta gacacttaag ctcgccttcg atctcagcgc agcggtgcag

     9001 ccacaacgcg cagcccgtgg gctcgtgatg cttgtaggtc acctctgcaa acgactgcag

     9061 gtacgcctgc aggaatcgcc ccatcatcgt cacaaaggtc ttgttgctgg tgaaggtcag

     9121 ctgcaacccg cggtgctcct cgttcagcca ggtcttgcat acggccgcca gagcttccac

     9181 ttggtcaggc agtagtttga agttcgcctt tagatcgtta tccacgtggt acttgtccat

     9241 cagcgcgcgc gcagcctcca tgcccttctc ccacgcagac acgatcggca cactcagcgg

     9301 gttcatcacc gtaatttcac tttccgcttc gctgggctct tcctcttcct cttgcgtccg

     9361 cataccacgc gccactgggt cgtcttcatt cagccgccgc actgtgcgct tacctccttt

     9421 gccatgcttg attagcaccg gtgggttgct gaaacccacc atttgtagcg ccacatcttc

     9481 tctttcttcc tcgctgtcca cgattacctc tggtgatggc gggcgctcgg gcttgggaga

     9541 agggcgcttc tttttcttct tgggcgcaat ggccaaatcc gccgccgagg tcgatggccg

     9601 cgggctgggt gtgcgcggca ccagcgcgtc ttgtgatgag tcttcctcgt cctcggactc

     9661 gatacgccgc ctcatccgct tttttggggg cgcccgggga ggcggcggcg acggggacgg

     9721 ggacgacacg tcctccatgg ttgggggacg tcgcgccgca ccgcgtccgc gctcgggggt

     9781 ggtttcgcgc tgctcctctt cccgactggc catttccttc tcctataggc agaaaaagat

     9841 catggagtca gtcgagaaga aggacagcct aaccgccccc tctgagttcg ccaccaccgc

     9901 ctccaccgat gccgccaacg cgcctaccac cttccccgtc gaggcacccc cgcttgagga

     9961 ggaggaagtg attatcgagc aggacccagg ttttgtaagc gaagacgacg aggaccgctc

    10021 agtaccaaca gaggataaaa agcaagacca ggacaacgca gaggcaaacg aggaacaagt

    10081 cgggcggggg gacgaaaggc atggcgacta cctagatgtg ggagacgacg tgctgttgaa

    10141 gcatctgcag cgccagtgcg ccattatctg cgacgcgttg caagagcgca gcgatgtgcc

    10201 cctcgccata gcggatgtca gccttgccta cgaacgccac ctattctcac cgcgcgtacc

    10261 ccccaaacgc caagaaaacg gcacatgcga gcccaacccg cgcctcaact tctaccccgt

    10321 atttgccgtg ccagaggtgc ttgccaccta tcacatcttt ttccaaaact gcaagatacc

    10381 cctatcctgc cgtgccaacc gcagccgagc ggacaagcag ctggccttgc ggcagggcgc

    10441 tgtcatacct gatatcgcct cgctcaacga agtgccaaaa atctttgagg gtcttggacg

    10501 cgacgagaag cgcgcggcaa acgctctgca acaggaaaac agcgaaaatg aaagtcactc

    10561 tggagtgttg gtggaactcg agggtgacaa cgcgcgccta gccgtactaa aacgcagcat

    10621 cgaggtcacc cactttgcct acccggcact taacctaccc cccaaggtca tgagcacagt

    10681 catgagtgag ctgatcgtgc gccgtgcgca gcccctggag agggatgcaa atttgcaaga

    10741 acaaacagag gagggcctac ccgcagttgg cgacgagcag ctagcgcgct ggcttcaaac

    10801 gcgcgagcct gccgacttgg aggagcgacg caaactaatg atggccgcag tgctcgttac

    10861 cgtggagctt gagtgcatgc agcggttctt tgctgacccg gagatgcagc gcaagctaga

    10921 ggaaacattg cactacacct ttcgacaggg ctacgtacgc caggcctgca agatctccaa

    10981 cgtggagctc tgcaacctgg tctcctacct tggaattttg cacgaaaacc gccttgggca

    11041 aaacgtgctt cattccacgc tcaagggcga ggcgcgccgc gactacgtcc gcgactgcgt

    11101 ttacttattt ctatgctaca cctggcagac ggccatgggc gtttggcagc agtgcttgga

    11161 ggagtgcaac ctcaaggagc tgcagaaact gctaaagcaa aacttgaagg acctatggac

    11221 ggccttcaac gagcgctccg tggccgcgca cctggcggac atcattttcc ccgaacgcct

    11281 gcttaaaacc ctgcaacagg gtctgccaga cttcaccagt caaagcatgt tgcagaactt

    11341 taggaacttt atcctagagc gctcaggaat cttgcccgcc acctgctgtg cacttcctag

    11401 cgactttgtg cccattaagt accgcgaatg ccctccgccg ctttggggcc actgctacct

    11461 tctgcagcta gccaactacc ttgcctacca ctctgacata atggaagacg tgagcggtga

    11521 cggtctactg gagtgtcact gtcgctgcaa cctatgcacc ccgcaccgct ccctggtttg

    11581 caattcgcag ctgcttaacg aaagtcaaat tatcggtacc tttgagctgc agggtccctc

    11641 gcctgacgaa aagtccgcgg ctccggggtt gaaactcact ccggggctgt ggacgtcggc

    11701 ttaccttcgc aaatttgtac ctgaggacta ccacgcccac gagattaggt tctacgaaga

    11761 ccaatcccgc ccgccaaatg cggagcttac cgcctgcgtc attacccagg gccacattct

    11821 tggccaattg caagccatca acaaagcccg ccaagagttt ctgctacgaa agggacgggg

    11881 ggtttacttg gacccccagt ccggcgagga gctcaaccca atccccccgc cgccgcagcc

    11941 ctatcagcag cagccgcggg cccttgcttc ccaggatggc acccaaaaag aagctgcagc

    12001 tgccgccgcc acccacggac gaggaggaat actgggacag tcaggcagag gaggttttgg

    12061 acgaggagga ggaggacatg atggaagact gggagagcct agacgaggaa gcttccgagg

    12121 tcgaagaggt gtcagacgaa acaccgtcac cctcggtcgc attcccctcg ccggcgcccc

    12181 agaaatcggc aaccggttcc agcatggcta caacctccgc tcctcaggcg ccgccggcac

    12241 tgcccgttcg ccgacccaac cgtagatggg acaccactgg aaccagggcc ggtaagtcca

    12301 agcagccgcc gccgttagcc caagagcaac aacagcgcca aggctaccgc tcatggcgcg

    12361 ggcacaagaa cgccatagtt gcttgcttgc aagactgtgg gggcaacatc tccttcgccc

    12421 gccgctttct tctctaccat cacggcgtgg ccttcccccg taacatcctg cattactacc

    12481 gtcatctcta cagcccatac tgcaccggcg gcagcggcag cggcagcaac agcagcggcc

    12541 acacagaagc aaaggcgacc ggatagcaag actctgacaa agcccaagaa atccacagcg

    12601 gcggcagcag caggaggagg agcgctgcgt ctggcgccca acgaacccgt atcgacccgc

    12661 gagcttagaa acaggatttt tcccactctg tatgctatat ttcaacagag caggggccaa

    12721 gaacaagagc tgaaaataaa aaacaggtct ctgcgatccc tcacccgcag ctgcctgtat

    12781 cacaaaagcg aagatcagct tcggcgcacg ctggaagacg cggaggctct cttcagtaaa

    12841 tactgcgcgc tgactcttaa ggactagttt cgcgcccttt ctcaaattta agcgcgaaaa

    12901 ctacgtcatc tccagcggcc acacccggcg ccagcacctg tcgtcagcgc cattatgagc

    12961 aaggaaattc ccacgcccta catgtggagt taccagccac aaatgggact tgcggctgga

    13021 gctgcccaag actactcaac ccgaataaac tacatgagcg cgggacccca catgatatcc

    13081 cgggtcaacg gaatccgcgc ccaccgaaac cgaattctct tggaacaggc ggctattacc

    13141 accacacctc gtaataacct taatccccgt agttggcccg ctgccctggt gtaccaggaa

    13201 agtcccgctc ccaccactgt ggtacttccc agagacgccc aggccgaagt tcagatgact

    13261 aactcagggg cgcagcttgc gggcggcttt cgtcacaggg tgcggtcgcc cgggcagggt

    13321 ataactcacc tgacaatcag agggcgaggt attcagctca acgacgagtc ggtgagctcc

    13381 tcgcttggtc tccgtccgga cgggacattt cagatcggcg gcgccggccg ctcttcattc

    13441 acgcctcgtc aggcaatcct aactctgcag acctcgtcct ctgagccgcg ctctggaggc

    13501 attggaactc tgcaatttat tgaggagttt gtgccatcgg tctactttaa ccccttctcg

    13561 ggacctcccg gccactatcc ggatcaattt attcctaact ttgacgcggt aaaggactcg

    13621 gcggatggct acgactgaat gttaagtgga gaggcagagc aactgcgcct gaaacacctg

    13681 gtccactgtc gccgccacaa gtgctttgcc cgcgactccg gtgagttttg ctactttgaa

    13741 ttgcccgagg atcatatcga gggcccggcg cacggcgtcc ggcttaccgc ccagggagag

    13801 cttgcccgta gcctgattcg ggagtttacc cagcgccccc tgctagttga gcgggacagg

    13861 ggaccctgtg ttctcactgt gatttgcaac tgtcctaacc ctggattaca tcaagatctt

    13921 tgttgccatc tctgtgctga gtataataaa tacagaaatt aaaatatact ggggctccta

    13981 tcgccatcct gtaaacgcca ccgtcttcac ccgcccaagc aaaccaaggc gaaccttacc

    14041 tggtactttt aacatctctc cctctgtgat ttacaacagt ttcaacccag acggagtgag

    14101 tctacgagag aacctctccg agctcagcta ctccatcaga aaaaacacca ccctccttac

    14161 ctgccgggaa cgtacgagtg cgtcaccggc cgctgcacca cacctaccgc ctgaccgtaa

    14221 accagacttt ttccggacag acctcaataa ctctgtttac cagaacagga ggtgagctta

    14281 gaaaaccctt agggtattag gccaaaggcg cagctactgt ggggtttatg aacaattcaa

    14341 gcaactctac gggctattct aattcaggtt tctctagaaa tggacggaat tattacagag

    14401 cagcgcctgc tagaaagacg cagggcagcg gccgagcaac agcgcatgaa tcaagagctc

    14461 caagacatgg ttaacttgca ccagtgcaaa aggggtatct tttgtctggt aaagcaggcc

    14521 aaagtcacct acgacagtaa taccaccgga caccgcctta gctacaagtt gccaaccaag

    14581 cgtcagaaat tggtggtcat ggtgggagaa aagcccatta ccataactca gcactcggta

    14641 gaaaccgaag gctgcattca ctcaccttgt caaggacctg aggatctctg cacccttatt

    14701 aagaccctgt gcggtctcaa agatcttatt ccctttaact aataaaaaaa aataataaag

    14761 catcacttac ttaaaatcag ttagcaaatt tctgtccagt ttattcagca gcacctcctt

    14821 gccctcctcc cagctctggt attgcagctt cctcctggct gcaaactttc tccacaatct

    14881 aaatggaatg tcagtttcct cctgttcctg tccatccgca cccactatct tcatgttgtt

    14941 gcagatgaag cgcgcaagac cgtctgaaga taccttcaac cccgtgtatc catatgacac

    15001 ggaaaccggt cctccaactg tgccttttct tactcctccc tttgtatccc ccaatgggtt

    15061 tcaagagagt ccccctgggg tactctcttt gcgcctatcc gaacctctag ttacctccaa

    15121 tggcatgctt gcgctcaaaa tgggcaacgg cctctctctg gacgaggccg gcaaccttac

    15181 ctcccaaaat gtaaccactg tgagcccacc tctcaaaaaa accaagtcaa acataaacct

    15241 ggaaatatct gcacccctca cagttacctc agaagcccta actgtggctg ccgccgcacc

    15301 tctaatggtc gcgggcaaca cactcaccat gcaatcacag gccccgctaa ccgtgcacga

    15361 ctccaaactt agcattgcca cccaaggacc cctcacagtg tcagaaggaa agctagccct

    15421 gcaaacatca ggccccctca ccaccaccga tagcagtacc cttactatca ctgcctcacc

    15481 ccctctaact actgccactg gtagcttggg cattgacttg aaagagccca tttatacaca

    15541 aaatggaaaa ctaggactaa agtacggggc tcctttgcat gtaacagacg acctaaacac

    15601 tttgaccgta gcaactggtc caggtgtgac tattaataat acttccttgc aaactaaagt

    15661 tactggagcc ttgggttttg attcacaagg caatatgcaa cttaatgtag caggaggact

    15721 aaggattgat tctcaaaaca gacgccttat acttgatgtt agttatccgt ttgatgctca

    15781 aaaccaacta aatctaagac taggacaggg ccctcttttt ataaactcag cccacaactt

    15841 ggatattaac tacaacaaag gcctttactt gtttacagct tcaaacaatt ccaaaaagct

    15901 tgaggttaac ctaagcactg ccaaggggtt gatgtttgac gctacagcca tagccattaa

    15961 tgcaggagat gggcttgaat ttggttcacc taatgcacca aacacaaatc ccctcaaaac

    16021 aaaaattggc catggcctag aatttgattc aaacaaggct atggttccta aactaggaac

    16081 tggccttagt tttgacagca caggtgccat tacagtagga aacaaaaata atgataagct

    16141 aactttgtgg accacaccag ctccatctcc taactgtaga ctaaatgcag agaaagatgc

    16201 taaactcact ttggtcttaa caaaatgtgg cagtcaaata cttgctacag tttcagtttt

    16261 ggctgttaaa ggcagtttgg ctccaatatc tggaacagtt caaagtgctc atcttattat

    16321 aagatttgac gaaaatggag tgctactaaa caattccttc ctggacccag aatattggaa

    16381 ctttagaaat ggagatctta ctgaaggcac agcctataca aacgctgttg gatttatgcc

    16441 taacctatca gcttatccaa aatctcacgg taaaactgcc aaaagtaaca ttgtcagtca

    16501 agtttactta aacggagaca aaactaaacc tgtaacacta accattacac taaacggtac

    16561 acaggaaaca ggagacacaa ctccaagtgc atactctatg tcattttcat gggactggtc

    16621 tggccacaac tacattaatg aaatatttgc cacatcctct tacacttttt catacattgc

    16681 ccaagaataa agaatcgttt gtgttatgtt tcaacgtgtt tatttttcaa ttgcagaaaa

    16741 tttcaagtca tttttcattc agtagtatag ccccaccacc acatagctta tacagatcac

    16801 cgtaccttaa tcaaactcac agaaccctag tattcaacct gccacctccc tcccaacaca

    16861 cagagtacac agtcctttct ccccggctgg ccttaaaaag catcatatca tgggtaacag

    16921 acatattctt aggtgttata ttccacacgg tttcctgtcg agccaaacgc tcatcagtga

    16981 tattaataaa ctccccgggc agctcactta agttcatgtc gctgtccagc tgctgagcca

    17041 caggctgctg tccaacttgc ggttgcttaa cgggcggcga aggagaagtc cacgcctaca

    17101 tgggggtaga gtcataatcg tgcatcagga tagggcggtg gtgctgcagc agcgcgcgaa

    17161 taaactgctg ccgccgccgc tccgtcctgc aggaatacaa catggcagtg gtctcctcag

    17221 cgatgattcg caccgcccgc agcataaggc gccttgtcct ccgggcacag cagcgcaccc

    17281 tgatctcact taaatcagca cagtaactgc agcacagcac cacaatattg ttcaaaatcc

    17341 cacagtgcaa ggcgctgtat ccaaagctca tggcggggac cacagaaccc acgtggccat

    17401 cataccacaa gcgcaggtag attaagtggc gacccctcat aaacacgctg gacataaaca

    17461 ttacctcttt tggcatgttg taattcacca cctcccggta ccatataaac ctctgattaa

    17521 acatggcgcc atccaccacc atcctaaacc agctggccaa aacctgcccg ccggctatac

    17581 actgcaggga accgggactg gaacaatgac agtggagagc ccaggactcg taaccatgga

    17641 tcatcatgct cgtcatgata tcaatgttgg cacaacacag gcacacgtgc atacacttcc

    17701 tcaggattac aagctcctcc cgcgttagaa ccatatccca gggaacaacc cattcctgaa

    17761 tcagcgtaaa tcccacactg cagggaagac ctcgcacgta actcacgttg tgcattgtca

    17821 aagtgttaca ttcgggcagc agcggatgat cctccagtat ggtagcgcgg gtttctgtct

    17881 caaaaggagg tagacgatcc ctactgtacg gagtgcgccg agacaaccga gatcgtgttg

    17941 gtcgtagtgt catgccaaat ggaacgccgg acgtagtcat atttcctgaa gcaaaaccag

    18001 gtgcgggcgt gacaaacaga tctgcgtctc cggtctcgcc gcttagatcg ctctgtgtag

    18061 tagttgtagt atatccactc tctcaaagca tccaggcgcc ccctggcttc gggttctatg

    18121 taaactcctt catgcgccgc tgccctgata acatccacca ccgcagaata agccacaccc

    18181 agccaaccta cacattcgtt ctgcgagtca cacacgggag gagcgggaag agctggaaga

    18241 accatgtttt tttttttatt ccaaaagatt atccaaaacc tcaaaatgaa gatctattaa

    18301 gtgaacgcgc tcccctccgg tggcgtggtc aaactctaca gccaaagaac agataatggc

    18361 atttgtaaga tgttgcacaa tggcttccaa aaggcaaacg gccctcacgt ccaagtggac

    18421 gtaaaggcta aacccttcag ggtgaatctc ctctataaac attccagcac cttcaaccat

    18481 gcccaaataa ttctcatctc gccaccttct caatatatct ctaagcaaat cccgaatatt

    18541 aagtccggcc attgtaaaaa tctgctccag agcgccctcc accttcagcc tcaagcagcg

    18601 aatcatgatt gcaaaaattc aggttcctca cagacctgta taagattcaa aagcggaaca

    18661 ttaacaaaaa taccgcgatc ccgtaggtcc cttcgcaggg ccagctgaac ataatcgtgc

    18721 aggtctgcac ggaccagcgc ggccacttcc ccgccaggaa ccatgacaaa agaacccaca

    18781 ctgattatga cacgcatact cggagctatg ctaaccagcg tagccccgat gtaagcttgt

    18841 tgcatgggcg gcgatataaa atgcaaggtg ctgctcaaaa aatcaggcaa agcctcgcgc

    18901 aaaaaagaaa gcacatcgta gtcatgctca tgcagataaa ggcaggtaag ctccggaacc

    18961 accacagaaa aagacaccat ttttctctca aacatgtctg cgggtttctg cataaacaca

    19021 aaataaaata acaaaaaaac atttaaacat tagaagcctg tcttacaaca ggaaaaacaa

    19081 cccttataag cataagacgg actacggcca tgccggcgtg accgtaaaaa aactggtcac

    19141 cgtgattaaa aagcaccacc gacagctcct cggtcatgtc cggagtcata atgtaagact

    19201 cggtaaacac atcaggttga ttcacatcgg tcagtgctaa aaagcgaccg aaatagcccg

    19261 ggggaataca tacccgcagg cgtagagaca acattacagc ccccatagga ggtataacaa

    19321 aattaatagg agagaaaaac acataaacac ctgaaaaacc ctcctgccta ggcaaaatag

    19381 caccctcccg ctccagaaca acatacagcg cttccacagc ggcagccata acagtcagcc

    19441 ttaccagtaa aaaagaaaac ctattaaaaa aacaccactc gacacggcac cagctcaatc

    19501 agtcacagtg taaaaaaggg ccaagtgcag agcgagtata tataggacta aaaaatgacg

    19561 taacggttaa agtccacaaa aaacacccag aaaaccgcac gcgaacctac gcccagaaac

    19621 gaaagccaaa aaacccacaa cttcctcaaa tcgtcacttc cgttttccca cgttacgtca

    19681 cttcccattt taagaaaact acaattccca acacatacaa gttactccgc cctaaaacct

    19741 acgtcacccg ccccgttccc acgccccgcg ccacgtcaca aactccaccc cctcattatc

    19801 atattggctt caatccaaaa taaggtatat tattgatgat gttaattaag aattcggatc

    19861 tgcgacgcga ggctggatgg ccttccccat tatgattctt ctcgcttccg gcggcatcgg

    19921 gatgcccgcg ttgcaggcca tgctgtccag gcaggtagat gacgaccatc agggacagct

    19981 tcacggccag caaaaggcca ggaaccgtaa aaaggccgcg ttgctggcgt ttttccatag

    20041 gctccgcccc cctgacgagc atcacaaaaa tcgacgctca agtcagaggt ggcgaaaccc

    20101 gacaggacta taaagatacc aggcgtttcc ccctggaagc tccctcgtgc gctctcctgt

    20161 tccgaccctg ccgcttaccg gatacctgtc cgcctttctc ccttcgggaa gcgtggcgct

    20221 ttctcaatgc tcacgctgta ggtatctcag ttcggtgtag gtcgttcgct ccaagctggg

    20281 ctgtgtgcac gaaccccccg ttcagcccga ccgctgcgcc ttatccggta actatcgtct

    20341 tgagtccaac ccggtaagac acgacttatc gccactggca gcagccactg gtaacaggat

    20401 tagcagagcg aggtatgtag gcggtgctac agagttcttg aagtggtggc ctaactacgg

    20461 ctacactaga aggacagtat ttggtatctg cgctctgctg aagccagtta ccttcggaaa

    20521 aagagttggt agctcttgat ccggcaaaca aaccaccgct ggtagcggtg gtttttttgt

    20581 ttgcaagcag cagattacgc gcagaaaaaa aggatctcaa gaagatcctt tgatcttttc

    20641 tacggggtct gacgctcagt ggaacgaaaa ctcacgttaa gggattttgg tcatgagatt

    20701 atcaaaaagg atcttcacct agatcctttt aaatcaatct aaagtatata tgagtaaact

    20761 tggtctgaca gttaccaatg cttaatcagt gaggcaccta tctcagcgat ctgtctattt

    20821 cgttcatcca tagttgcctg actccccgtc gtgtagataa ctacgatacg ggagggctta

    20881 ccatctggcc ccagtgctgc aatgataccg cgagacccac gctcaccggc tccagattta

    20941 tcagcaataa accagccagc cggaagggcc gagcgcagaa gtggtcctgc aactttatcc

    21001 gcctccatcc agtctattaa ttgttgccgg gaagctagag taagtagttc gccagttaat

    21061 agtttgcgca acgttgttgc cattgttgca ggcatcgtgg tgtcacgctc gtcgtttggt

    21121 atggcttcat tcagctccgg ttcccaacga tcaaggcgag ttacatgatc ccccatgttg

    21181 tgcaaaaaag cggttagctc cttcggtcct ccgatcgttg tcagaagtaa gttggccgca

    21241 gtgttatcac tcatggttat ggcagcactg cataattctc ttactgtcat gccatccgta

    21301 agatgctttt ctgtgactgg tgagtactca accaagtcat tctgagaata gtgtatgcgg

    21361 cgaccgagtt gctcttgccc ggcgtcaaca cgggataata ccgcgccaca tagcagaact

    21421 ttaaaagtgc tcatcattgg aaaacgttct tcggggcgaa aactctcaag gatcttaccg

    21481 ctgttgagat ccagttcgat gtaacccact cgtgcaccca actgatcttc agcatctttt

    21541 actttcacca gcgtttctgg gtgagcaaaa acaggaaggc aaaatgccgc aaaaaaggga

    21601 ataagggcga cacggaaatg ttgaatactc atactcttcc tttttcaata ttattgaagc

    21661 atttatcagg gttattgtct catgagcgga tacatatttg aatgtattta gaaaaataaa

    21721 caaatagggg ttccgcgcac atttccccga aaagtgccac ctgacgtcta agaaaccatt

    21781 attatcatga cattaaccta taaaaatagg cgtatcacga ggccctttcg tcttcaa

//

 

Caution:
Product is for research use only!

No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart