pAcGP67A

$216.00

  • Model: PVT5109
  • 50 Units in Stock
Ask a question


Add to Cart:

pAcGP67A

PVT5109       2ug
 

pAcGP67A Pladmid information

Promoter: Polyhedrin
Replicon: ColE1 ori
Terminator: polyhedrin 3
Plasmid classification: insect cell vector; baculovirus forming secretory expression plasmid
Plasmid size: 9761bp
Plasmid Tags: N-GP67 signal
Prokaryotic resistance: ampicillin Ampicillin
Clone strain: DH5 alpha
Culture conditions: 37, aerobic, LB
Expressing host: insect cells
Induction: constitutive expression, without induction
Primers for 5'sequencing: Polyhedrin-F:AAATGATAACCATCTCGC
Primers for 3'sequencing: Polyhedrin-R:GTCCAAGTTTCCCTG
Remark: GP67 secreted signal peptide
Use:Insect cell plasmid

 

pAcGP67A Pladmid Description

The acidic glycoprotein gp67 (syn.: gp64) is the most abundant envelope surface glycoprotein of the Autographa californica nuclear polyhedrosis virus (AcNPV baculovirus), and is essential for the entry of baculovirus particles into susceptible insect cells. Since large amounts of this protein are secreted and anchored to the virus peplomer, its gene contains one of the most effective baculovirus-encoded signal sequences for protein secretion. Therefore, we have constructed baculovirus transfer vectors that contain the gp67 signal sequence in front of a multiple cloning site. A gene of choice can be inserted in one of these cloning sites and the protein of interest will be expressed as a gp67 signal peptide fusion protein under the control of the strong baculovirus polyhedrin promoter. This strategy allows the forced secretion of otherwise non-secreted recombinant proteins which may be easily purified when serum-free insect culture medium, BD BaculoGold Max-XP Insect Cell Medium is used. The transfer vector(s) should be preferentially used in conjunction with BD BaculoGold DNA .

 

pAcGP67A Pladmid Sequence

LOCUS       Exported                9761 bp ds-DNA     circular SYN 26-AUG-2016

DEFINITION  synthetic circular DNA

ACCESSION   .

VERSION     .

KEYWORDS    pAcGP67A

SOURCE      synthetic DNA construct

  ORGANISM  synthetic DNA construct

REFERENCE   1  (bases 1 to 9761)

  AUTHORS   .

  TITLE     Direct Submission

  JOURNAL   Exported Friday, August 26, 2016 from SnapGene Viewer 3.1.4

FEATURES             Location/Qualifiers

     source          1..9761

                     /organism="synthetic DNA construct"

                     /mol_type="other DNA"

     misc_recomb     3170..3997

                     /note="baculovirus recombination region (lef2/ORF603)"

                     /note="contains ORF603 and part of lef2"

     CDS             3170..3294

                     /codon_start=3

                     /product="baculovirus late expression factor 2"

                     /note="lef2"

                     /translation="HLLIKSQDVYKPPNCQKMKTVDKLCPFAGNCKGLNPICNY"

     CDS             complement(3332..3937)

                     /codon_start=1

                     /product="baculovirus ORF603 protein"

                     /note="ORF603"

                     /translation="MAVIFNNKQLLADNSIEKGGELFLFNGSYNILESYVNPVLLKNGV

                     IELEEAAYYAGNILYKTDDPKFIDYINLIIKATHSEELPENSTVVNYRKTMRSGTIHPI

                     KKDIYIYDNKKFTLYDRYIYGYDNNYVNFYEEKNEKEKEYEEEDDKASSLCENKIILSQ

                     INCESFENDFKYYLSDYNYAFSIIDNTTNVLVAFGLYR"

     promoter        4001..4092

                     /gene="polh from Autographa californica"

                     /note="polyhedrin promoter"

                     /note="promoter for the baculovirus polyhedrin gene"

     CDS             4189..4248

                     /codon_start=1

                     /gene="Autographa californica gp64"

                     /product="signal sequence from the baculovirus envelope 

                     glycoprotein GP64"

                     /note="GP64 signal sequence"

                     /translation="MVSAIVLYVLLAAAAHSAFA"

     misc_recomb     4776..5481

                     /note="baculovirus recombination region (ORF1629)"

                     /note="contains part of ORF1629"

     3'UTR           4864..5236

                     /note="polyhedrin 3' UTR"

                     /note="3' UTR from the Autographa californica 

                     nucleopolyhedrovirus polyhedrin gene (Suzuki et al., 2006)"

     CDS             complement(4893..5481)

                     /codon_start=2

                     /product="baculovirus capsid-associated protein"

                     /note="ORF1629"

                     /note="required for viral replication"

                     /translation="IPKSSTTNLIADVLADTINRRRVAMAKSSSEATSNDEGWDDDDNR

                     PNKANTPDVKYVQALFNVFTSSQLYTNDSDERNTKAHNILNDVEPLLQNKTQTNIDKAR

                     LLLQDLASFVALSENPLDSPAIGSEKQPLFETNRNLFYKSIEDLIFKFRYKDAENHLIF

                     ALTYHPKDYKFNELLKYVQQLSVNQQRTESSA"

     CDS             complement(5915..5932)

                     /codon_start=1

                     /product="6xHis affinity tag"

                     /note="6xHis"

                     /translation="HHHHHH"

     primer_bind     complement(7142..7158)

                     /note="M13 rev"

                     /note="common sequencing primer, one of multiple similar 

                     variants"

     protein_bind    7166..7182

                     /bound_moiety="lac repressor encoded by lacI"

                     /note="lac operator"

                     /note="The lac repressor binds to the lac operator to 

                     inhibit transcription in E. coli. This inhibition can be 

                     relieved by adding lactose or 

                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."

     promoter        complement(7190..7220)

                     /note="lac promoter"

                     /note="promoter for the E. coli lac operon"

     protein_bind    7235..7256

                     /bound_moiety="E. coli catabolite activator protein"

                     /note="CAP binding site"

                     /note="CAP binding activates transcription in the presence 

                     of cAMP."

     rep_origin      complement(7544..8132)

                     /direction=LEFT

                     /note="ori"

                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 

                     replication"

     CDS             complement(8303..9163)

                     /codon_start=1

                     /gene="bla"

                     /product="beta-lactamase"

                     /note="AmpR"

                     /note="confers resistance to ampicillin, carbenicillin, and

                     related antibiotics"

                     /translation="[TEM beta-lactamase fragment, 45 aa]

                     ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVEYS

                     [TEM beta-lactamase fragment, 59 aa]

                     EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA

                     [TEM beta-lactamase fragment, 59 aa]

                     LIKHW"

     promoter        complement(9164..9268)

                     /gene="bla"

                     /note="AmpR promoter"

     primer_bind     9742..9758

                     /note="M13 fwd"

                     /note="common sequencing primer, one of multiple similar 

                     variants"

ORIGIN

        1 aagctttact cgtaaagcga gttgaaggat catatttagt tgcgtttatg agataagatt

       61 gaaagcacgt gtaaaatgtt tcccgcgcgt tggcacaact atttacaatg cggccaagtt

      121 ataaaagatt ctaatctgat atgttttaaa acacctttgc ggcccgagtt gtttgcgtac

      181 gtgactagcg aagaagatgt gtggaccgca gaacagatag taaaacaaaa ccctagtatt

      241 ggagcaataa tcgatttaac caacacgtct aaatattatg atggtgtgca ttttttgcgg

      301 gcgggcctgt tatacaaaaa aattcaagta cctggccaga ctttgccgcc tgaaagcata

      361 gttcaagaat ttattgacac ggtaaaagaa tttacagaaa agtgtcccgg catgttggtg

      421 ggcgtgcact gcacacacgg tattaatcgc accggttaca tggtgtgcag atatttaatg

      481 cacaccctgg gtattgcgcc gcaggaagcc atagatagat tcgaaaaagc cagaggtcac

      541 aaaattgaaa gacaaaatta cgttcaagat ttattaattt aattaatatt atttgcattc

      601 tttaacaaat actttatcct attttcaaat tgttgcgctt cttccagcga accaaaacta

      661 tgcttcgctt gctccgttta gcttgtagcc gatcagtggc gttgttccaa tcgacggtag

      721 gattaggccg gatattctcc accacaatgt tggcaacgtt gatgttacgt ttatgctttt

      781 ggttttccac gtacgtcttt tggccggtaa tagccgtaaa cgtagtgccg tcgcgcgtca

      841 cgcacaacac cggatgtttg cgcttgtccg cggggtattg aaccgcgcga tccgacaaat

      901 ccaccacttt ggcaactaaa tcggtgacct gcgcgtcttt tttctgcatt atttcgtctt

      961 tcttttgcat ggtttcctgg aagccggtgt acatgcggtt tagatcagtc atgacgcgcg

     1021 tgacctgcaa atctttggcc tcgatctgct tgtccttgat ggcaacgatg cgttcaataa

     1081 actcttgttt tttaacaagt tcctcggttt tttgcgccac caccgcttgc agcgcgtttg

     1141 tgtgctcggt gaatgtcgca atcagcttag tcaccaactg tttgctctcc tcctcccgtt

     1201 gtttgatcgc gggatcgtac ttgccggtgc agagcacttg aggaattact tcttctaaaa

     1261 gccattcttg taattctatg gcgtaaggca atttggactt cataatcagc tgaatcacgc

     1321 cggatttagt aatgagcact gtatgcggct gcaaatacag cgggtcgccc cttttcacga

     1381 cgctgttaga ggtagggccc ccattttgga tggtctgctc aaataacgat ttgtatttat

     1441 tgtctacatg aacacgtata gctttatcac aaactgtata ttttaaactg ttagcgacgt

     1501 ccttggccac gaaccggacc tgttggtcgc gctctagcac gtaccgcagg ttgaacgtat

     1561 cttctccaaa tttaaattct ccaattttaa cgcgagccat tttgatacac gtgtgtcgat

     1621 tttgcaacaa ctattgtttt ttaacgcaaa ctaaacttat tgtggtaagc aataattaaa

     1681 tatgggggaa catgcgccgc tacaacactc gtcgttatga acgcagacgg cgccggtctc

     1741 ggcgcaagcg gctaaaacgt gttgcgcgtt caacgcggca aacatcgcaa aagccaatag

     1801 tacagttttg atttgcatat taacggcgat tttttaaatt atcttattta ataaatagtt

     1861 atgacgccta caactccccg cccgcgttga ctcgctgcac ctcgagcagt tcgttgacgc

     1921 cttcctccgt gtggccgaac acgtcgagcg ggtggtcgat gaccagcggc gtgccgcacg

     1981 cgacgcacaa gtatctgtac accgaatgat cgtcgggcga aggcacgtcg gcctccaagt

     2041 ggcaatattg gcaaattcga aaatatatac agttgggttg tttgcgcata tctatcgtgg

     2101 cgttgggcat gtacgtccga acgttgattt gcatgcaagc cgaaattaaa tcattgcgat

     2161 tagtgcgatt aaaacgttgt acatcctcgc ttttaatcat gccgtcgatt aaatcgcgca

     2221 atcgagtcaa gtgatcaaag tgtggaataa tgttttcttt gtattcccga gtcaagcgca

     2281 gcgcgtattt taacaaacta gccatcttgt aagttagttt catttaatgc aactttatcc

     2341 aataatatat tatgtatcgc acgtcaagaa ttaacaatgc gcccgttgtc gcatctcaac

     2401 acgactatga tagagatcaa ataaagcgcg aattaaatag cttgcgacgc aacgtgcacg

     2461 atctgtgcac gcgttccggc acgagctttg attgtaataa gtttttacga agcgatgaca

     2521 tgacccccgt agtgacaacg atcacgccca aaagaactgc cgactacaaa attaccgagt

     2581 atgtcggtga cgttaaaact attaagccat ccaatcgacc gttagtcgaa tcaggaccgc

     2641 tggtgcgaga agccgcgaag tatggcgaat gcatcgtata acgtgtggag tccgctcatt

     2701 agagcgtcat gtttagacaa gaaagctaca tatttaattg atcccgatga ttttattgat

     2761 aaattgaccc taactccata cacggtattc tacaatggcg gggttttggt caaaatttcc

     2821 ggactgcgat tgtacatgct gttaacggct ccgcccacta ttaatgaaat taaaaattcc

     2881 aattttaaaa aacgcagcaa gagaaacatt tgtatgaaag aatgcgtaga aggaaagaaa

     2941 aatgtcgtcg acatgctgaa caacaagatt aatatgcctc cgtgtataaa aaaaatattg

     3001 aacgatttga aagaaaacaa tgtaccgcgc ggcggtatgt acaggaagag gtttatacta

     3061 aactgttaca ttgcaaacgt ggtttcgtgt gccaagtgtg aaaaccgatg tttaatcaag

     3121 gctctgacgc atttctacaa ccacgactcc aagtgtgtgg gtgaagtcat gcatctttta

     3181 atcaaatccc aagatgtgta taaaccacca aactgccaaa aaatgaaaac tgtcgacaag

     3241 ctctgtccgt ttgctggcaa ctgcaagggt ctcaatccta tttgtaatta ttgaataata

     3301 aaacaattat aaatgctaaa tttgtttttt attaacgata caaaccaaac gcaacaagaa

     3361 catttgtagt attatctata attgaaaacg cgtagttata atcgctgagg taatatttaa

     3421 aatcattttc aaatgattca cagttaattt gcgacaatat aattttattt tcacataaac

     3481 tagacgcctt gtcgtcttct tcttcgtatt ccttctcttt ttcatttttc tcctcataaa

     3541 aattaacata gttattatcg tatccatata tgtatctatc gtatagagta aattttttgt

     3601 tgtcataaat atatatgtct tttttaatgg ggtgtatagt accgctgcgc atagtttttc

     3661 tgtaatttac aacagtgcta ttttctggta gttcttcgga gtgtgttgct ttaattatta

     3721 aatttatata atcaatgaat ttgggatcgt cggttttgta caatatgttg ccggcatagt

     3781 acgcagcttc ttctagttca attacaccat tttttagcag caccggatta acataacttt

     3841 ccaaaatgtt gtacgaaccg ttaaacaaaa acagttcacc tcccttttct atactattgt

     3901 ctgcgagcag ttgtttgttg ttaaaaataa cagccattgt aatgagacgc acaaactaat

     3961 atcacaaact ggaaatgtct atcaatatat agttgctgat atcatggaga taattaaaat

     4021 gataaccatc tcgcaaataa ataagtattt tactgttttc gtaacagttt tgtaataaaa

     4081 aaacctataa atattccgga ttattcatac cgtcccacca tcgggcgcgg atctatgcta

     4141 ctagtaaatc agtcacacca aggcttcaat aaggaacaca caagcaagat ggtaagcgct

     4201 attgttttat atgtgctttt ggcggcggcg gcgcattctg cctttgcggc ggatcccggg

     4261 taccttctag aattccggag cggccgctgc agatctgatc ctttcctggg acccggcaag

     4321 aaccaaaaac tcactctctt caaggaaatc cgtaatgtta aacccgacac gatgaagctt

     4381 gtcgttggat ggaaaggaaa agagttctac agggaaactt ggacccgctt catggaagac

     4441 agcttcccca ttgttaacga ccaagaagtg atggatgttt tccttgttgt caacatgcgt

     4501 cccactagac ccaaccgttg ttacaaattc ctggcccaac acgctctgcg ttgcgacccc

     4561 gactatgtac ctcatgacgt gattaggatc gtcgagcctt catgggtggg cagcaacaac

     4621 gagtaccgca tcagcctggc taagaagggc ggcggctgcc caataatgaa ccttcactct

     4681 gagtacacca actcgttcga acagttcatc gatcgtgtca tctgggagaa cttctacaag

     4741 cccatcgttt acatcggtac cgactctgct gaagaggagg aaattctcct tgaagtttcc

     4801 ctggtgttca aagtaaagga gtttgcacca gacgcacctc tgttcactgg tccggcgtat

     4861 taaaacacga tacattgtta ttagtacatt tattaagcgc tagattctgt gcgttgttga

     4921 tttacagaca attgttgtac gtattttaat aattcattaa atttataatc tttagggtgg

     4981 tatgttagag cgaaaatcaa atgattttca gcgtctttat atctgaattt aaatattaaa

     5041 tcctcaatag atttgtaaaa taggtttcga ttagtttcaa acaagggttg tttttccgaa

     5101 ccgatggctg gactatctaa tggattttcg ctcaacgcca caaaacttgc caaatcttgt

     5161 agcagcaatc tagctttgtc gatattcgtt tgtgttttgt tttgtaataa aggttcgacg

     5221 tcgttcaaaa tattatgcgc ttttgtattt ctttcatcac tgtcgttagt gtacaattga

     5281 ctcgacgtaa acacgttaaa taaagcttgg acatatttaa catcgggcgt gttagcttta

     5341 ttaggccgat tatcgtcgtc gtcccaaccc tcgtcgttag aagttgcttc cgaagacgat

     5401 tttgccatag ccacacgacg cctattaatt gtgtcggcta acacgtccgc gatcaaattt

     5461 gtagttgagc tttttggaat tatttctgat tgcgggcgtt tttgggcggg tttcaatcta

     5521 actgtgcccg attttaattc agacaacacg ttagaaagcg atggtgcagg cggtggtaac

     5581 atttcagacg gcaaatctac taatggcggc ggtggtggag ctgatgataa atctaccatc

     5641 ggtggaggcg caggcggggc tggcggcgga ggcggaggcg gaggtggtgg cggtgatgca

     5701 gacggcggtt taggctcaaa tgtctcttta ggcaacacag tcggcacctc aactattgta

     5761 ctggtttcgg gcgccgtttt tggtttgacc ggtctgagac gagtgcgatt tttttcgttt

     5821 ctaatagctt ccaacaattg ttgtctgtcg tctaaaggtg cagcgggttg aggttccgtc

     5881 ggcattggtg gagcgggcgg caattcagac atcgatggtg gtggtggtgg tggaggcgct

     5941 ggaatgttag gcacgggaga aggtggtggc ggcggtgccg ccggtataat ttgttctggt

     6001 ttagtttgtt cgcgcacgat tgtgggcacc ggcgcaggcg ccgctggctg cacaacggaa

     6061 ggtcgtctgc ttcgaggcag cgcttggggt ggtggcaatt caatattata attggaatac

     6121 aaatcgtaaa aatctgctat aagcattgta atttcgctat cgtttaccgt gccgatattt

     6181 aacaaccgct caatgtaagc aattgtattg taaagagatt gtctcaagct ccgcacgccg

     6241 ataacaagcc ttttcatttt tactacagca ttgtagtggc gagacacttc gctgtcgtcg

     6301 acgtacatgt atgctttgtt gtcaaaaacg tcgttggcaa gctttaaaat atttaaaaga

     6361 acatctctgt tcagcaccac tgtgttgtcg taaatgttgt ttttgataat ttgcgcttcc

     6421 gcagtatcga cacgttcaaa aaattgatgc gcatcaattt tgttgttcct attattgaat

     6481 aaataagatt gtacagattc atatctacga ttcgtcatgg ccaccacaaa tgctacgctg

     6541 caaacgctgg tacaatttta cgaaaactgc aaaaacgtca aaactcggta taaaataatc

     6601 aacgggcgct ttggcaaaat atctatttta tcgcacaagc ccactagcaa attgtatttg

     6661 cagaaaacaa tttcggcgca caattttaac gctgacgaaa taaaagttca ccagttaatg

     6721 agcgaccacc caaattttat aaaaatctat tttaatcacg gttccatcaa caaccaagtg

     6781 atcgtgatgg actacattga ctgtcccgat ttatttgaaa cactacaaat taaaggcgag

     6841 ctttcgtacc aacttgttag caatattatt agacagctgt gtgaagcgct caacgatttg

     6901 cacaagcaca atttcataca caacgacata aaactcgaaa atgtcttata tttcgaagca

     6961 cttgatcgcg tgtatgtttg cgattacgga ttgtgcaaac acgaaaactc acttagcgtg

     7021 cacgacggca cgttggagta ttttagtccg gaaaaaattc gacacacaac tatgcacgtt

     7081 tcgtttgact ggtacgcggc gtgttaacat acaagttgct aaccggcggt tcgtaatcat

     7141 ggtcatagct gtttcctgtg tgaaattgtt atccgctcac aattccacac aacatacgag

     7201 ccggaagcat aaagtgtaaa gcctggggtg cctaatgagt gagctaactc acattaattg

     7261 cgttgcgctc actgcccgct ttccagtcgg gaaacctgtc gtgccagctg cattaatgaa

     7321 tcggccaacg cgcggggaga ggcggtttgc gtattgggcg ctcttccgct tcctcgctca

     7381 ctgactcgct gcgctcggtc gttcggctgc ggcgagcggt atcagctcac tcaaaggcgg

     7441 taatacggtt atccacagaa tcaggggata acgcaggaaa gaacatgtga gcaaaaggcc

     7501 agcaaaaggc caggaaccgt aaaaaggccg cgttgctggc gtttttccat aggctccgcc

     7561 cccctgacga gcatcacaaa aatcgacgct caagtcagag gtggcgaaac ccgacaggac

     7621 tataaagata ccaggcgttt ccccctggaa gctccctcgt gcgctctcct gttccgaccc

     7681 tgccgcttac cggatacctg tccgcctttc tcccttcggg aagcgtggcg ctttctcata

     7741 gctcacgctg taggtatctc agttcggtgt aggtcgttcg ctccaagctg ggctgtgtgc

     7801 acgaaccccc cgttcagccc gaccgctgcg ccttatccgg taactatcgt cttgagtcca

     7861 acccggtaag acacgactta tcgccactgg cagcagccac tggtaacagg attagcagag

     7921 cgaggtatgt aggcggtgct acagagttct tgaagtggtg gcctaactac ggctacacta

     7981 gaaggacagt atttggtatc tgcgctctgc tgaagccagt taccttcgga aaaagagttg

     8041 gtagctcttg atccggcaaa caaaccaccg ctggtagcgg tggttttttt gtttgcaagc

     8101 agcagattac gcgcagaaaa aaaggatctc aagaagatcc tttgatcttt tctacggggt

     8161 ctgacgctca gtggaacgaa aactcacgtt aagggatttt ggtcatgaga ttatcaaaaa

     8221 ggatcttcac ctagatcctt ttaaattaaa aatgaagttt taaatcaatc taaagtatat

     8281 atgagtaaac ttggtctgac agttaccaat gcttaatcag tgaggcacct atctcagcga

     8341 tctgtctatt tcgttcatcc atagttgcct gactccccgt cgtgtagata actacgatac

     8401 gggagggctt accatctggc cccagtgctg caatgatacc gcgagaccca cgctcaccgg

     8461 ctccagattt atcagcaata aaccagccag ccggaagggc cgagcgcaga agtggtcctg

     8521 caactttatc cgcctccatc cagtctatta attgttgccg ggaagctaga gtaagtagtt

     8581 cgccagttaa tagtttgcgc aacgttgttg ccattgctac aggcatcgtg gtgtcacgct

     8641 cgtcgtttgg tatggcttca ttcagctccg gttcccaacg atcaaggcga gttacatgat

     8701 cccccatgtt gtgcaaaaaa gcggttagct ccttcggtcc tccgatcgtt gtcagaagta

     8761 agttggccgc agtgttatca ctcatggtta tggcagcact gcataattct cttactgtca

     8821 tgccatccgt aagatgcttt tctgtgactg gtgagtactc aaccaagtca ttctgagaat

     8881 agtgtatgcg gcgaccgagt tgctcttgcc cggcgtcaat acgggataat accgcgccac

     8941 atagcagaac tttaaaagtg ctcatcattg gaaaacgttc ttcggggcga aaactctcaa

     9001 ggatcttacc gctgttgaga tccagttcga tgtaacccac tcgtgcaccc aactgatctt

     9061 cagcatcttt tactttcacc agcgtttctg ggtgagcaaa aacaggaagg caaaatgccg

     9121 caaaaaaggg aataagggcg acacggaaat gttgaatact catactcttc ctttttcaat

     9181 attattgaag catttatcag ggttattgtc tcatgagcgg atacatattt gaatgtattt

     9241 agaaaaataa acaaataggg gttccgcgca catttccccg aaaagtgcca cctgacgtct

     9301 aagaaaccat tattatcatg acattaacct ataaaaatag gcgtatcacg aggccctttc

     9361 gtctcgcgcg tttcggtgat gacggtgaaa acctctgaca catgcagctc ccggagacgg

     9421 tcacagcttg tctgtaagcg gatgccggga gcagacaagc ccgtcagggc gcgtcagcgg

     9481 gtgttggcgg gtgtcggggc tggcttaact atgcggcatc agagcagatt gtactgagag

     9541 tgcaccatat gcggtgtgaa ataccgcaca gatgcgtaag gagaaaatac cgcatcaggc

     9601 gccattcgcc attcaggctg cgcaactgtt gggaagggcg atcggtgcgg gcctcttcgc

     9661 tattacgcca gctggcgaaa gggggatgtg ctgcaaggcg attaagttgg gtaacgccag

     9721 ggttttccca gtcacgacgt tgtaaaacga cggccagtgc c

//

 

Caution:
Product is for research use only!


Search name

pAcGP67A,Plasmid pAcGP67A,pAcGP67A vector

 

No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart