pACYC177

$162.00

  • Model: PVT0017
  • 49 Units in Stock
Ask a question


Add to Cart:

pACYC177

PVT0017    2ug
 

pACYC177 Information

Replicon: p15A ori

Plasmid size: 3941bp

Prokaryotic resistance: ampicillin Amp; kanamycin Kan

Cloned strain: DH5 alpha

Culture conditions: 37 centigrade, aerobic, LB

5'sequencing primers: Based on sequence design

3'sequencing primers: Based on sequence design

Note: rich enzyme cutting site

 

pACYC177 Description

pACYC177 is an E. coli plasmid cloning vector containing the p15A origin of replication (1-4). This allows pACYC177 to coexist in cells with plasmids of the ColE1 compatibility group (e.g., pBR322, pUC19). It is a low copy number vector, at about 15 copies per cell (5), but can be amplified with chloramphenicol or spectinomycin. Enzymes with unique restriction sites are shown in bold type and enzymes with two restriction sites are shown in regular type. Location of sites of all NEB restriction enzymes can be found on the NEB web site (choose Technical Reference > DNA Sequences and Maps). Restriction site coordinates refer to the position of the 5′-most base on the top strand in each recognition sequence.

 

pACYC177 Sequence

LOCUS       Exported                3941 bp ds-DNA     circular SYN 26-8-2015
DEFINITION  synthetic circular DNA
KEYWORDS    Untitled
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 3941)
  TITLE     Direct Submission
FEATURES             Location/Qualifiers
     source          1..3941
                     /organism="synthetic DNA construct"
                     /mol_type="other DNA"
     rep_origin      783..1328
                     /direction=RIGHT
                     /note="p15A ori"
                     /note="Plasmids containing the medium-copy-number p15A
                     origin of replication can be propagated in E. coli cells
                     that contain a second plasmid with the ColE1 origin."
     CDS             1923..2738
                     /codon_start=1
                     /product="aminoglycoside phosphotransferase"
                     /note="KanR"
                     /note="confers resistance to kanamycin in bacteria or G418
                     (Geneticin(R)) in eukaryotes"
                     /translation="MSHIQRETSCSRPRLNSNMDADLYGYKWARDNVGQSGATIYRLYG
                     KPDAPELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGK
                     TAFQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDA
                     SDFDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGI
                     ADRYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF"
     CDS             1923..2738
                     /codon_start=1
                     /gene="aph(3')-Ia"
                     /product="aminoglycoside phosphotransferase"
                     /note="KanR"
                     /note="confers resistance to kanamycin in bacteria or G418
                     (Geneticin(R)) in eukaryotes"
                     /translation="MSHIQRETSCSRPRLNSNMDADLYGYKWARDNVGQSGATIYRLYG
                     KPDAPELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGK
                     TAFQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDA
                     SDFDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGI
                     ADRYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF"
     promoter        3594..3698
                     /gene="bla"
                     /note="AmpR promoter"
     CDS             3699..618
                     /codon_start=1
                     /gene="bla"
                     /product="beta-lactamase"
                     /note="AmpR"
                     /note="confers resistance to ampicillin, carbenicillin, and
                     related antibiotics"
                     /translation="[TEM beta-lactamase fragment, 45 aa]
                     ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS
                     [TEM beta-lactamase fragment, 59 aa]
                     EPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA
                     [TEM beta-lactamase fragment, 59 aa]
                     LIKHW"
ORIGIN
        1 gttgacgccg ggcaagagca actcggtcgc cgcatacact attctcagaa tgacttggtt
       61 gagtactcac cagtcacaga aaagcatctt acggatggca tgacagtaag agaattatgc
      121 agtgctgcca taaccatgag tgataacact gcggccaact tacttctgac aacgatcgga
      181 ggaccgaagg agctaaccgc ttttttgcac aacatggggg atcatgtaac tcgccttgat
      241 cgttgggaac cggagctgaa tgaagccata ccaaacgacg agcgtgacac cacgatgcct
      301 gcagcaatgg caacaacgtt gcgcaaacta ttaactggcg aactacttac tctagcttcc
      361 cggcaacaat taatagactg gatggaggcg gataaagttg caggaccact tctgcgctcg
      421 gcccttccgg ctggctggtt tattgctgat aaatctggag ccggtgagcg tgggtctcgc
      481 ggtatcattg cagcactggg gccagatggt aagccctccc gtatcgtagt tatctacacg
      541 acggggagtc aggcaactat ggatgaacga aatagacaga tcgctgagat aggtgcctca
      601 ctgattaagc attggtaact gtcagaccaa gtttactcat atatacttta gattgattta
      661 aaacttcatt tttaatttaa aaggatctag gtgaagatcc tttttgataa tctcatgacc
      721 aaaatccctt aacgtgagtt ttcgttccac tgagcgtcag accccttaat aagatgatct
      781 tcttgagatc gttttggtct gcgcgtaatc tcttgctctg aaaacgaaaa aaccgccttg
      841 cagggcggtt tttcgaaggt tctctgagct accaactctt tgaaccgagg taactggctt
      901 ggaggagcgc agtcaccaaa acttgtcctt tcagtttagc cttaaccggc gcatgacttc
      961 aagactaact cctctaaatc aattaccagt ggctgctgcc agtggtgctt ttgcatgtct
     1021 ttccgggttg gactcaagac gatagttacc ggataaggcg cagcggtcgg actgaacggg
     1081 gggttcgtgc atacagtcca gcttggagcg aactgcctac ccggaactga gtgtcaggcg
     1141 tggaatgaga caaacgcggc cataacagcg gaatgacacc ggtaaaccga aaggcaggaa
     1201 caggagagcg cacgagggag ccgccagggg gaaacgcctg gtatctttat agtcctgtcg
     1261 ggtttcgcca ccactgattt gagcgtcaga tttcgtgatg cttgtcaggg gggcggagcc
     1321 tatggaaaaa cggctttgcc gcggccctct cacttccctg ttaagtatct tcctggcatc
     1381 ttccaggaaa tctccgcccc gttcgtaagc catttccgct cgccgcagtc gaacgaccga
     1441 gcgtagcgag tcagtgagcg aggaagcgga atatatcctg tatcacatat tctgctgacg
     1501 caccggtgca gccttttttc tcctgccaca tgaagcactt cactgacacc ctcatcagtg
     1561 ccaacatagt aagccagtat acactccgct agcgctgagg tctgcctcgt gaagaaggtg
     1621 ttgctgactc ataccaggcc tgaatcgccc catcatccag ccagaaagtg agggagccac
     1681 ggttgatgag agctttgttg taggtggacc agttggtgat tttgaacttt tgctttgcca
     1741 cggaacggtc tgcgttgtcg ggaagatgcg tgatctgatc cttcaactca gcaaaagttc
     1801 gatttattca acaaagccac gttgtgtctc aaaatctctg atgttacatt gcacaagata
     1861 aaaatatatc atcatgaaca ataaaactgt ctgcttacat aaacagtaat acaaggggtg
     1921 ttatgagcca tattcaacgg gaaacgtctt gctcgaggcc gcgattaaat tccaacatgg
     1981 atgctgattt atatgggtat aaatgggctc gcgataatgt cgggcaatca ggtgcgacaa
     2041 tctatcgatt gtatgggaag cccgatgcgc cagagttgtt tctgaaacat ggcaaaggta
     2101 gcgttgccaa tgatgttaca gatgagatgg tcagactaaa ctggctgacg gaatttatgc
     2161 ctcttccgac catcaagcat tttatccgta ctcctgatga tgcatggtta ctcaccactg
     2221 cgatccccgg gaaaacagca ttccaggtat tagaagaata tcctgattca ggtgaaaata
     2281 ttgttgatgc gctggcagtg ttcctgcgcc ggttgcattc gattcctgtt tgtaattgtc
     2341 cttttaacag cgatcgcgta tttcgtctcg ctcaggcgca atcacgaatg aataacggtt
     2401 tggttgatgc gagtgatttt gatgacgagc gtaatggctg gcctgttgaa caagtctgga
     2461 aagaaatgca taagcttttg ccattctcac cggattcagt cgtcactcat ggtgatttct
     2521 cacttgataa ccttattttt gacgagggga aattaatagg ttgtattgat gttggacgag
     2581 tcggaatcgc agaccgatac caggatcttg ccatcctatg gaactgcctc ggtgagtttt
     2641 ctccttcatt acagaaacgg ctttttcaaa aatatggtat tgataatcct gatatgaata
     2701 aattgcagtt tcatttgatg ctcgatgagt ttttctaatc agaattggtt aattggttgt
     2761 aacactggca gagcattacg ctgacttgac gggacggcgg ctttgttgaa taaatcgaac
     2821 ttttgctgag ttgaaggatc agatcacgca tcttcccgac aacgcagacc gttccgtggc
     2881 aaagcaaaag ttcaaaatca ccaactggtc cacctacaac aaagctctca tcaaccgtgg
     2941 ctccctcact ttctggctgg atgatggggc gattcaggcc tggtatgagt cagcaacacc
     3001 ttcttcacga ggcagacctc agcgctcaaa gatgcagggg taaaagctaa ccgcatcttt
     3061 accgacaagg catccggcag ttcaacagat cgggaagggc tggatttgct gaggatgaag
     3121 gtggaggaag gtgatgtcat tctggtgaag aagctcgacc gtcttggccg cgacaccgcc
     3181 gacatgatcc aactgataaa agagtttgat gctcagggtg tagcggttcg gtttattgac
     3241 gacgggatca gtaccgacgg tgatatgggg caaatggtgg tcaccatcct gtcggctgtg
     3301 gcacaggctg aacgccggag gatcctagag cgcacgaatg agggccgaca ggaagcaaag
     3361 ctgaaaggaa tcaaatttgg ccgcaggcgt accgtggaca ggaacgtcgt gctgacgctt
     3421 catcagaagg gcactggtgc aacggaaatt gctcatcagc tcagtattgc ccgctccacg
     3481 gtttataaaa ttcttgaaga cgaaagggcc tcgtgatacg cctattttta taggttaatg
     3541 tcatgataat aatggtttct tagacgtcag gtggcacttt tcggggaaat gtgcgcggaa
     3601 cccctatttg tttatttttc taaatacatt caaatatgta tccgctcatg agacaataac
     3661 cctgataaat gcttcaataa tattgaaaaa ggaagagtat gagtattcaa catttccgtg
     3721 tcgcccttat tccctttttt gcggcatttt gccttcctgt ttttgctcac ccagaaacgc
     3781 tggtgaaagt aaaagatgct gaagatcagt tgggtgcacg agtgggttac atcgaactgg
     3841 atctcaacag cggtaagatc cttgagagtt ttcgccccga agaacgtttt ccaatgatga
     3901 gcacttttaa agttctgcta tgtggcgcgg tattatcccg t
//

 

Caution:
1.  This product is FOR RESEARCH USE ONLY!
2.  The item is lyophilized form, Please take the powder plasmid by centrifugation at 5000rpm/min for 1min. Add 20μl ddH2O in to the tube of plasmid.

 

Search name

pACYC177,Plasmid pACYC177,pACYC177 vector

No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart