pAdEasy- 1 Plasmid

$216.00

  • Model: PVT2002
  • 50 Units in Stock
Ask a question


Add to Cart:

pAdEasy-1

Search name

pAdEasy-1,Plasmid pAdEasy-1,pAdEasy-1 vector

 

pAdEasy-1 Information

Replicon: pUC ori

Plasmid classification: virus series, adenovirus vector

Plasmid size: 33477bp

Prokaryotic resistance: Amp

Clone strain: Stbl3

Culture conditions: 37 C, aerobic LB

Expression host: lactation cells

Induction mode: no need to induce, transient expression.

5'sequencing primers: M13F:TGTAAAACGACGGCCAGT

Primers for 3'sequencing: primers designed based on sequences

 

pAdEasy-1 Description

The plasmid pAdEasy-1, containing most of the human adenovirus serotype 5 (Ad5) genome, is deleted for the genes E1 and E3. The removal of these two viral genes creates space for foreign DNA and eliminates selfreplication capabilities. The E1 deletion renders the viruses defective for replication and incapable of producing infectious viral particles in target cells (provided there is no complementation by the host cell); the E3 region encodes proteins involved in evading host immunity and is dispensable. The deletion of both genes creates room for up to 7.5 kb of foreign DNA that can be inserted into the Ad5 genome. The E1 gene, which is necessary for production of viral particles, is provided in trans by AD-293 cells. pAdEasy-1 carries the ampicillin resistance gene, which is lost after recombination with a shuttle vector.

 

 

pAdEasy-1 Sequence

LOCUS       Exported               33477 bp ds-DNA     circular SYN 06-SEP-2016
DEFINITION  synthetic circular DNA
ACCESSION   .
VERSION     .
KEYWORDS    Untitled 6
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 33477)
  AUTHORS   .
  TITLE     Direct Submission
  JOURNAL   Exported Tuesday, September 6, 2016 from SnapGene Viewer 3.1.4
        
FEATURES             Location/Qualifiers
     source          1..33477
                     /organism="synthetic DNA construct"
                     /mol_type="other DNA"
     CDS             1037..1228
                     /codon_start=1
                     /gene="rop"
                     /product="Rop protein, which maintains plasmids at low copy
                     number"
                     /note="rop"
                     /translation="MTKQEKTALNMARFIRSQTLTLLEKLNELDADEQADICESLHDHA
                     DELYRSCLARFGDDGENL"
     misc_feature    1330..1470
                     /note="bom"
                     /note="basis of mobility region from pBR322"
     rep_origin      complement(1656..2244)
                     /direction=LEFT
                     /note="ori"
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     CDS             complement(2415..3275)
                     /codon_start=1
                     /gene="bla"
                     /product="beta-lactamase"
                     /note="AmpR"
                     /note="confers resistance to ampicillin, carbenicillin, and
                     related antibiotics"
                     /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI
                     ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS
                     PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW
                     EPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA
                     LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS
                     LIKHW"
     promoter        complement(3276..3380)
                     /gene="bla"
                     /note="AmpR promoter"
     misc_feature    6972..7075
                     /note="Ad SA"
                     /note="adenovirus major late transcript splice acceptor 
                     (Friedrich and Soriano, 1991)"
     CDS             complement(14168..14179)
                     /codon_start=1
                     /product="Factor Xa recognition and cleavage site"
                     /note="Factor Xa site"
                     /translation="IEGR"
     repeat_region   33121..33223
                     /note="ITR"
                     /note="inverted terminal repeat of human adenovirus 
                     serotype 5"
ORIGIN
        1 tcgtcactgg tcccgccacc aaacgtttcg gcgagaagca ggccattatc gccggcatgg
       61 cggccgacgc gctgggctac gtcttgctgg cgttcgcgac gcgaggctgg atggccttcc
      121 ccattatgat tcttctcgct tccggcggca tcgggatgcc cgcgttgcag gccatgctgt
      181 ccaggcaggt agatgacgac catcagggac agcttcaagg atcgctcgcg gctcttacca
      241 gcctaacttc gatcattgga ccgctgatcg tcacggcgat ttatgccgcc tcggcgagca
      301 catggaacgg gttggcatgg attgtaggcg ccgccctata ccttgtctgc ctccccgcgt
      361 tgcgtcgcgg tgcatggagc cgggccacct cgacctgaat ggaagccggc ggcacctcgc
      421 taacggattc accactccaa gaattggagc caatcaattc ttgcggagaa ctgtgaatgc
      481 gcaaaccaac ccttggcaga acatatccat cgcgtccgcc atctccagca gccgcacgcg
      541 gcgcatctcg ggcagcgttg ggtcctggcc acgggtgcgc atgatcgtgc tcctgtcgtt
      601 gaggacccgg ctaggctggc ggggttgcct tactggttag cagaatgaat caccgatacg
      661 cgagcgaacg tgaagcgact gctgctgcaa aacgtctgcg acctgagcaa caacatgaat
      721 ggtcttcggt ttccgtgttt cgtaaagtct ggaaacgcgg aagtcagcgc cctgcaccat
      781 tatgttccgg atctgcatcg caggatgctg ctggctaccc tgtggaacac ctacatctgt
      841 attaacgaag cgctggcatt gaccctgagt gatttttctc tggtcccgcc gcatccatac
      901 cgccagttgt ttaccctcac aacgttccag taaccgggca tgttcatcat cagtaacccg
      961 tatcgtgagc atcctctctc gtttcatcgg tatcattacc cccatgaaca gaaatccccc
     1021 ttacacggag gcatcagtga ccaaacagga aaaaaccgcc cttaacatgg cccgctttat
     1081 cagaagccag acattaacgc ttctggagaa actcaacgag ctggacgcgg atgaacaggc
     1141 agacatctgt gaatcgcttc acgaccacgc tgatgagctt taccgcagct gcctcgcgcg
     1201 tttcggtgat gacggtgaaa acctctgaca catgcagctc ccggagacgg tcacagcttg
     1261 tctgtaagcg gatgccggga gcagacaagc ccgtcagggc gcgtcagcgg gtgttggcgg
     1321 gtgtcggggc gcagccatga cccagtcacg tagcgatagc ggagtgtata ctggcttaac
     1381 tatgcggcat cagagcagat tgtactgaga gtgcaccata tgcggtgtga aataccgcac
     1441 agatgcgtaa ggagaaaata ccgcatcagg cgctcttccg cttcctcgct cactgactcg
     1501 ctgcgctcgg tcgttcggct gcggcgagcg gtatcagctc actcaaaggc ggtaatacgg
     1561 ttatccacag aatcagggga taacgcagga aagaacatgt gagcaaaagg ccagcaaaag
     1621 gccaggaacc gtaaaaaggc cgcgttgctg gcgtttttcc ataggctccg cccccctgac
     1681 gagcatcaca aaaatcgacg ctcaagtcag aggtggcgaa acccgacagg actataaaga
     1741 taccaggcgt ttccccctgg aagctccctc gtgcgctctc ctgttccgac cctgccgctt
     1801 accggatacc tgtccgcctt tctcccttcg ggaagcgtgg cgctttctca tagctcacgc
     1861 tgtaggtatc tcagttcggt gtaggtcgtt cgctccaagc tgggctgtgt gcacgaaccc
     1921 cccgttcagc ccgaccgctg cgccttatcc ggtaactatc gtcttgagtc caacccggta
     1981 agacacgact tatcgccact ggcagcagcc actggtaaca ggattagcag agcgaggtat
     2041 gtaggcggtg ctacagagtt cttgaagtgg tggcctaact acggctacac tagaaggaca
     2101 gtatttggta tctgcgctct gctgaagcca gttaccttcg gaaaaagagt tggtagctct
     2161 tgatccggca aacaaaccac cgctggtagc ggtggttttt ttgtttgcaa gcagcagatt
     2221 acgcgcagaa aaaaaggatc tcaagaagat cctttgatct tttctacggg gtctgacgct
     2281 cagtggaacg aaaactcacg ttaagggatt ttggtcatga gattatcaaa aaggatcttc
     2341 acctagatcc ttttaaatta aaaatgaagt tttaaatcaa tctaaagtat atatgagtaa
     2401 acttggtctg acagttacca atgcttaatc agtgaggcac ctatctcagc gatctgtcta
     2461 tttcgttcat ccatagttgc ctgactcccc gtcgtgtaga taactacgat acgggagggc
     2521 ttaccatctg gccccagtgc tgcaatgata ccgcgagacc cacgctcacc ggctccagat
No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart