pAdTrack- CMV Plasmid

$136.00

  • Model: PVT2003
  • 50 Units in Stock
Ask a question


Add to Cart:

pAdTrack-CMV

Search name

pAdTrack-CMV,Plasmid pAdTrack-CMV,pAdTrack-CMV vector

 

pAdTrack-CMV Information

Promoter: CMV promoter

Replicon: pUC ori

Terminator: SV40 poly (A) signal

Plasmid size: 9237bp

Prokaryotic resistance: Kan

Selection marker: Neo

Clone strain: Stbl3

Culture conditions: 37 C, aerobic, LB

Induction mode: no induction, instantaneous expression

 

pAdTrack-CMV Description

PAdTrack-CMV transgenic adenovirus vector to cell expression vector with CMV promoter and EGFP gene expression of green fluorescent protein tracking results, and use common pAdeasy1 vector maximum can be inserted into the 5.9kb, the use of common pAdeasy2 carrier can insert the 8.6kb. The specific use of the method can refer to the pAdeasy carrier system. Recombinant adenoviruses provide a versatile system for gene expression studies and therapeutic applications. We here report a strategy which simplifies the generation and production of such viruses. A recombinant adenoviral plasmid is generated with a minimum of enzymatic manipulations, employing homologous recombination in bacteria rather than in eucaryotic cells. Following transfections of such plasmids into a mammalian packaging cell line, viral production is conveniently followed with the aid of green fluorescent protein, encoded by a gene incorporated into the viral backbone. Homogeneous viruses can be obtained from this procedure without plaque purification.This system should expedite the process of generating and testing recombinant adenoviruses for a variety of purposes.

 

pAdTrack-CMV Multiple cloning site

pAdTrack-CMV-vector

 

 

pAdTrack-CMV Sequence

LOCUS       Exported                9237 bp ds-DNA     circular SYN 27-AUG-2016
DEFINITION  synthetic circular DNA
KEYWORDS    Untitled 3
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 9237)
  TITLE     Direct Submission
            
FEATURES             Location/Qualifiers
     source          1..9237
                     /organism="synthetic DNA construct"
                     /mol_type="other DNA"
     repeat_region   79..181
                     /note="ITR"
                     /note="inverted terminal repeat of human adenovirus 
                     serotype 5"
     enhancer        3440..3743
                     /note="CMV enhancer"
                     /note="human cytomegalovirus immediate early enhancer"
     promoter        3744..3947
                     /note="CMV promoter"
                     /note="human cytomegalovirus (CMV) immediate early 
                     promoter"
     polyA_signal    4158..4279
                     /note="SV40 poly(A) signal"
                     /note="SV40 polyadenylation signal"
     enhancer        4365..4668
                     /note="CMV enhancer"
                     /note="human cytomegalovirus immediate early enhancer"
     promoter        4669..4872
                     /note="CMV promoter"
                     /note="human cytomegalovirus (CMV) immediate early 
                     promoter"
     CDS             4917..5633
                     /codon_start=1
                     /product="enhanced GFP"
                     /note="EGFP"
                     /note="mammalian codon-optimized"
                     /translation="MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTL
                     KFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDD
                     GNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIK
                     VNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLL
                     EFVTAAGITLGMDELYK"
     polyA_signal    5772..5893
                     /note="SV40 poly(A) signal"
                     /note="SV40 polyadenylation signal"
     misc_signal     6036..6186
                     /note="Ad5 Psi"
                     /note="packaging signal for adenovirus serotype 5"
     repeat_region   6274..6376
                     /note="ITR"
                     /note="inverted terminal repeat of human adenovirus 
                     serotype 5"
     rep_origin      6414..6794
                     /direction=RIGHT
                     /note="M13 ori"
                     /note="M13 bacteriophage origin of replication; arrow 
                     indicates direction of (+) strand synthesis"
     CDS             complement(6842..7636)
                     /codon_start=1
                     /gene="aph(3')-II (or nptII)"
                     /product="aminoglycoside phosphotransferase from Tn5"
                     /note="NeoR/KanR"
                     /note="confers resistance to neomycin, kanamycin, and G418 
                     (Geneticin(R))"
                     /translation="MIEQDGLHAGSPAAWVERLFGYDWAQQTIGCSDAAVFRLSAQGRP
                     VLFVKTDLSGALNELQDEAARLSWLATTGVPCAAVLDVVTEAGRDWLLLGEVPGQDLLS
                     SHLAPAEKVSIMADAMRRLHTLDPATCPFDHQAKHRIERARTRMEAGLVDQDDLDEEHQ
                     GLAPAELFARLKASMPDGEDLVVTHGDACLPNIMVENGRFSGFIDCGRLGVADRYQDIA
                     LATRDIAEELGGEWADRFLVLYGIAAPDSQRIAFYRLLDEFF"
     rep_origin      8468..9056
                     /direction=RIGHT
                     /note="ori"
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
ORIGIN
        1 agcgcctgat gcggtatttt ctccttacgc atctgtgcgg tatttcacac cgcatatgga
       61 tccatgcatg ttaattaaca tcatcaataa tataccttat tttggattga agccaatatg
      121 ataatgaggg ggtggagttt gtgacgtggc gcggggcgtg ggaacggggc gggtgacgta
      181 ggttttaggg cggagtaact tgtatgtgtt gggaattgta gttttcttaa aatgggaagt
      241 gacgtaacgt gggaaaacgg aagtgacgat ttgaggaagt tgtgggtttt ttggctttcg
      301 tttctgggcg taggttcgcg tgcggttttc tgggtgtttt ttgtggactt taaccgttac
      361 gtcatttttt agtcctatat atactcgctc tgcacttggc ccttttttac actgtgactg
      421 attgagctgg tgccgtgtcg agtggtgttt ttttaatagg ttttcttttt tactggtaag
      481 gctgactgtt atggctgccg ctgtggaagc gctgtatgtt gttctggagc gggagggtgc
      541 tattttgcct aggcaggagg gtttttcagg tgtttatgtg tttttctctc ctattaattt
      601 tgttatacct cctatggggg ctgtaatgtt gtctctacgc ctgcgggtat gtattccccc
      661 gggctatttc ggtcgctttt tagcactgac cgatgtgaat caacctgatg tgtttaccga
      721 gtcttacatt atgactccgg acatgaccga ggagctgtcg gtggtgcttt ttaatcacgg
      781 tgaccagttt ttttacggtc acgccggcat ggccgtagtc cgtcttatgc ttataagggt
      841 tgtttttcct gttgtaagac aggcttctaa tgtttaaatg tttttttgtt attttatttt
      901 gtgtttatgc agaaacccgc agacatgttt gagagaaaaa tggtgtcttt ttctgtggtg
      961 gttccggagc ttacctgcct ttatctgcat gagcatgact acgatgtgct ttcttttttg
     1021 cgcgaggctt tgcctgattt tttgagcagc accttgcatt ttatatcgcc gcccatgcaa
     1081 caagctattg aattcgttta aactccctct caagtctgta tacggggaca cggacagcct
     1141 tttcgtcacc gagcgtggac accggctcat ggaaaccaga ggtaagaaac gcatcaaaaa
     1201 gcatggggga aacctggttt ttgaccccga acggccagag ctcacctggc tcgtggaatg
     1261 cgagaccgtc tgcggggcct gcggcgcgga tgcctactcc ccggaatcgg tatttctcgc
     1321 gcccaagctc tacgccctca aaagtctgca ctgcccctcg tgcggcgcct cctccaaggg
     1381 caagctgcgc gccaagggcc acgccgcgga ggggctggac tatgacacca tggtcaaatg
     1441 ctacctggcc gacgcgcagg gcgaagaccg gcagcgcttc agcaccagca ggaccagcct
     1501 caagcgcacc ctggccagcg cgcagcccgg agcgcacccc ttcaccgtga cccagactac
No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart