pAN7- 1 Plasmid

$256.00

  • Model: PVT5301
  • 50 Units in Stock
Ask a question


Add to Cart:

pAN7-1

Search name

pAN7-1,Plasmid pAN7-1,pAN7-1 vector

pAN7- 1 Plasmid information

Promoter: gpdA
Replicon: pUC ori
Terminator: TRPC
Plasmids: other host vectors; filamentous fungal expression plasmids
Plasmid size: 6756bp
Prokaryotic resistance: ampicillin Ampicillin
Screening markers: hygromycin Hygromycin
Cloned strain: DH5 alpha
Culture conditions: 37 centigrade, aerobic, LB
Expression host: filamentous fungi
Culture conditions: Reference Literature
Induction mode: no induction
5'sequencing primers: Based on full sequence design
3'sequencing primers: Based on full sequence design
Note: NCBI: Z32698.1
Use:Filamentous fungal plasmid

pAN7- 1 Plasmid description

Reference

1、Effect of de-phosphorylation of linearized pAN7-1 and of addition of restriction enzyme on plasmid integration in Penicillium paxilli.
2、Transformation of sapstaining fungi with hygromycin B resistance plasmids pAN7-1 and pCB1004.
3、Padro de integrao de pAN7-1 em mutantes de Magnaporthe grisea com patogenicidade alterada em arroz.
4、Integração de pAN7-1 no Genoma de Magnaporthe grisea Mediada por Enzima de Restrição.
5、Primary structure of the trpC gene from Aspergillus nidulans.
6、Transformation of Aspergillus based on the hygromycin B resistance marker from Escherichia coli.
7、Functional elements in the promoter region of the Aspergillus nidulans gpdA gene encoding glyceraldehyde-3-phosphate dehydrogenase

pAN7-1-Plasmid

pAN7- 1 Plasmid Sequence

LOCUS       Z32698                  6756 bp    DNA     linear   SYN 14-NOV-2006
DEFINITION  Expression vector (PAN7-1) DNA, 6756bp.
ACCESSION   Z32698
VERSION     Z32698.1  GI:475166
KEYWORDS    hygromycin b phosphotransferase.
SOURCE      synthetic construct
  ORGANISM  synthetic construct
            other sequences; artificial sequences.
REFERENCE   1
  AUTHORS   Mullaney,E.J., Hamer,J.E., Roberti,K.A., Yelton,M.M. and
            Timberlake,W.E.
  TITLE     Primary structure of the trpC gene from Aspergillus nidulans
  JOURNAL   Mol. Gen. Genet. 199 (1), 37-45 (1985)
   PUBMED   3158796
  REMARK    sites .
REFERENCE   2
  AUTHORS   Punt,P.J., Oliver,R.P., Dingemanse,M.A., Pouwels,P.H. and van den
            Hondel,C.A.
  TITLE     Transformation of Aspergillus based on the hygromycin B resistance
            marker from Escherichia coli
  JOURNAL   Gene 56 (1), 117-124 (1987)
   PUBMED   2824287
  REMARK    (sites)
REFERENCE   3  (bases 999 to 2572)
  AUTHORS   Punt,P.J., Dingemanse,M.A., Kuyvenhoven,A., Soede,R.D.,
            Pouwels,P.H. and van den Hondel,C.A.
  TITLE     Functional elements in the promoter region of the Aspergillus
            nidulans gpdA gene encoding glyceraldehyde-3-phosphate
            dehydrogenase
  JOURNAL   Gene 93 (1), 101-109 (1990)
   PUBMED   2121607
REFERENCE   4  (bases 1 to 6756)
  AUTHORS   Punt,P.
  TITLE     Direct Submission
  JOURNAL   Submitted (22-APR-1994) Punt P., TNO Nutrition and Food Research
            Institute, Lange Kleiweg 139, Rijkswik, The Netherlands
FEATURES             Location/Qualifiers
     source          1..6756
                     /organism="synthetic construct"
                     /mol_type="other DNA"
                     /db_xref="taxon:32630"
     misc_feature    1..6756
                     /product="fungal transformation vector pAN7-1"
                     /standard_name="HPH"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /citation=[2]
                     /phenotype="gene product confers resistance to hygromycin
                     B"
     regulatory      1..2129
                     /regulatory_class="promoter"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /citation=[2]
                     /citation=[3]
                     /function="promoter region of the A.nidulans gpdA gene"
     gene            2130
                     /gene="gpdA"
     misc_feature    2130
                     /gene="gpdA"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /citation=[3]
                     /function="major transcription start site"
     intron          2178..2293
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /citation=[3]
                     /number=1
     gene            2302..3321
                     /gene="HPH"
     CDS             2302..3321
                     /gene="HPH"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="gene-product confers resistance to hygromycin B"
                     /citation=[2]
                     /citation=[3]
                     /codon_start=1
                     /transl_table=11
                     /product="hygromycin B phosphotransferase"
                     /protein_id="CAA83647.1"
                     /db_xref="GI:475167"
                     /translation="MPELTATSVEKFLIEKFDSVSDLMQLSEGEESRAFSFDVGGRGY
                     VLRVNSCADGFYKDRYVYRHFASAALPIPEVLDIGEFSESLTYCISRRAQGVTLQDLP
                     ETELPAVLQPVAEAMDAIAAADLSQTSGFGPFGPQGIGQYTTWRDFICAIADPHVYHW
                     QTVMDDTVSASVAQALDELMLWAEDCPEVRHLVHADFGSNNVLTDNGRITAVIDWSEA
                     MFGDSQYEVANIFFWRPWLACMEQQTRYFERRHPELAGSPRLRAYMLRIGLDQLYQSL
                     VDGNFDDAAWAQGRCDAIVRSGAGTVGRTQIARRSAAVWTDGCVEVLADSGNRRPSTR
                     PRAKE"
     regulatory      3339..4108
                     /regulatory_class="terminator"
                     /standard_name="terminator region from A.nidulans trpC
                     gene (containing CDS)"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="this region contains the 3'end of the trpC
                     transcript including 50 codons. two major transcription
                     ends have been identified"
                     /citation=[1]
No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart