pAN7-1

$256.00

  • Model: PVT5301
  • 50 Units in Stock
Ask a question


Add to Cart:

pAN7-1

PVT5301      2ug
 

pAN7- 1 Plasmid information

Promoter: gpdA
Replicon: pUC ori
Terminator: TRPC
Plasmids: other host vectors; filamentous fungal expression plasmids
Plasmid size: 6756bp
Prokaryotic resistance: ampicillin Ampicillin
Screening markers: hygromycin Hygromycin
Cloned strain: DH5 alpha
Culture conditions: 37 centigrade, aerobic, LB
Expression host: filamentous fungi
Culture conditions: Reference Literature
Induction mode: no induction
5'sequencing primers: Based on full sequence design
3'sequencing primers: Based on full sequence design
Note: NCBI: Z32698.1
Use:Filamentous fungal plasmid

pAN7- 1 Plasmid description

Reference

1、Effect of de-phosphorylation of linearized pAN7-1 and of addition of restriction enzyme on plasmid integration in Penicillium paxilli.
2、Transformation of sapstaining fungi with hygromycin B resistance plasmids pAN7-1 and pCB1004.
3、Padro de integrao de pAN7-1 em mutantes de Magnaporthe grisea com patogenicidade alterada em arroz.
4、Integração de pAN7-1 no Genoma de Magnaporthe grisea Mediada por Enzima de Restrição.
5、Primary structure of the trpC gene from Aspergillus nidulans.
6、Transformation of Aspergillus based on the hygromycin B resistance marker from Escherichia coli.
7、Functional elements in the promoter region of the Aspergillus nidulans gpdA gene encoding glyceraldehyde-3-phosphate dehydrogenase

pAN7-1-Plasmid


pAN7- 1 Plasmid Sequence

LOCUS       Z32698                  6756 bp    DNA     linear   SYN 14-NOV-2006

DEFINITION  Expression vector (PAN7-1) DNA, 6756bp.

ACCESSION   Z32698

VERSION     Z32698.1  GI:475166

KEYWORDS    hygromycin b phosphotransferase.

SOURCE      synthetic construct

  ORGANISM  synthetic construct

            other sequences; artificial sequences.

REFERENCE   1

  AUTHORS   Mullaney,E.J., Hamer,J.E., Roberti,K.A., Yelton,M.M. and

            Timberlake,W.E.

  TITLE     Primary structure of the trpC gene from Aspergillus nidulans

  JOURNAL   Mol. Gen. Genet. 199 (1), 37-45 (1985)

   PUBMED   3158796

  REMARK    sites .

REFERENCE   2

  AUTHORS   Punt,P.J., Oliver,R.P., Dingemanse,M.A., Pouwels,P.H. and van den

            Hondel,C.A.

  TITLE     Transformation of Aspergillus based on the hygromycin B resistance

            marker from Escherichia coli

  JOURNAL   Gene 56 (1), 117-124 (1987)

   PUBMED   2824287

  REMARK    (sites)

REFERENCE   3  (bases 999 to 2572)

  AUTHORS   Punt,P.J., Dingemanse,M.A., Kuyvenhoven,A., Soede,R.D.,

            Pouwels,P.H. and van den Hondel,C.A.

  TITLE     Functional elements in the promoter region of the Aspergillus

            nidulans gpdA gene encoding glyceraldehyde-3-phosphate

            dehydrogenase

  JOURNAL   Gene 93 (1), 101-109 (1990)

   PUBMED   2121607

REFERENCE   4  (bases 1 to 6756)

  AUTHORS   Punt,P.

  TITLE     Direct Submission

  JOURNAL   Submitted (22-APR-1994) Punt P., TNO Nutrition and Food Research

            Institute, Lange Kleiweg 139, Rijkswik, The Netherlands

FEATURES             Location/Qualifiers

     source          1..6756

                     /organism="synthetic construct"

                     /mol_type="other DNA"

                     /db_xref="taxon:32630"

     misc_feature    1..6756

                     /product="fungal transformation vector pAN7-1"

                     /standard_name="HPH"

                     /experiment="experimental evidence, no additional details

                     recorded"

                     /citation=[2]

                     /phenotype="gene product confers resistance to hygromycin

                     B"

     regulatory      1..2129

                     /regulatory_class="promoter"

                     /experiment="experimental evidence, no additional details

                     recorded"

                     /citation=[2]

                     /citation=[3]

                     /function="promoter region of the A.nidulans gpdA gene"

     gene            2130

                     /gene="gpdA"

     misc_feature    2130

                     /gene="gpdA"

                     /experiment="experimental evidence, no additional details

                     recorded"

                     /citation=[3]

                     /function="major transcription start site"

     intron          2178..2293

                     /experiment="experimental evidence, no additional details

                     recorded"

                     /citation=[3]

                     /number=1

     gene            2302..3321

                     /gene="HPH"

     CDS             2302..3321

                     /gene="HPH"

                     /experiment="experimental evidence, no additional details

                     recorded"

                     /note="gene-product confers resistance to hygromycin B"

                     /citation=[2]

                     /citation=[3]

                     /codon_start=1

                     /transl_table=11

                     /product="hygromycin B phosphotransferase"

                     /protein_id="CAA83647.1"

                     /db_xref="GI:475167"

                     /translation="MPELTATSVEKFLIEKFDSVSDLMQLSEGEESRAFSFDVGGRGY

                     VLRVNSCADGFYKDRYVYRHFASAALPIPEVLDIGEFSESLTYCISRRAQGVTLQDLP

                     ETELPAVLQPVAEAMDAIAAADLSQTSGFGPFGPQGIGQYTTWRDFICAIADPHVYHW

                     QTVMDDTVSASVAQALDELMLWAEDCPEVRHLVHADFGSNNVLTDNGRITAVIDWSEA

                     MFGDSQYEVANIFFWRPWLACMEQQTRYFERRHPELAGSPRLRAYMLRIGLDQLYQSL

                     VDGNFDDAAWAQGRCDAIVRSGAGTVGRTQIARRSAAVWTDGCVEVLADSGNRRPSTR

                     PRAKE"

     regulatory      3339..4108

                     /regulatory_class="terminator"

                     /standard_name="terminator region from A.nidulans trpC

                     gene (containing CDS)"

                     /experiment="experimental evidence, no additional details

                     recorded"

                     /note="this region contains the 3'end of the trpC

                     transcript including 50 codons. two major transcription

                     ends have been identified"

                     /citation=[1]

                     /citation=[2]

     polyA_site      3590..3600

     misc_difference 3600..3610

                     /note="introduction of one base at this position generates

                     an BLGI site with was shown to be present by restriction

                     digestion"

                     /citation=[1]

                     /replace="gccttncaggc"

     misc_difference 3809..3817

                     /note="introduction of one base at this position generates

                     an ALWNI site which was shown to be present by restriction

                     digestion"

                     /citation=[1]

                     /replace="cagcncctg"

     polyA_site      3863..3873

     misc_difference 3897..3907

                     /note="introduction (actual sequence could be deletion as

                     well) of a base at this position results in the

                     elimination of an XMNI site which was shown to be absent

                     by restriction digestion"

                     /citation=[1]

                     /replace="gaaatcanttc"

     variation       3934..3941

                     /note="A NCOI site present at this position was removed by

                     digestion, treatment with klenow polymerase and

                     religation"

                     /citation=[2]

                     /replace="catgcatg"

     misc_feature    4105..6756

                     /product="PUC18"

                     /note="vector sequences derived from PUC18 from SALI TO

                     ECORI"

                     /citation=[2]

ORIGIN      

        1 gaattccctt gtatctctac acacaggctc aaatcaataa gaagaacggt tcgtcttttt

       61 cgtttatatc ttgcatcgtc ccaaagctat tggcgggata ttctgtttgc agttggctga

      121 cttgaagtaa tctctgcaga tctttcgaca ctgaaatacg tcgagcctgc tccgcttgga

      181 agcggcgagg agcctcgtcc tgtcacaact accaacatgg agtacgataa gggccagttc

      241 cgccagctca ttaagagcca gttcatgggc gttggcatga tggccgtcat gcatctgtac

      301 ttcaagtaca ccaacgctct tctgatccag tcgatcatcc gctgaaggcg ctttcgaatc

      361 tggttaagat ccacgtcttc gggaagccag cgactggtga cctccagcgt ccctttaagg

      421 ctgccaacag ctttctcagc cagggccagc ccaagaccga caaggcctcc ctccagaacg

      481 ccgagaagaa ctggaggggt ggtgtcaagg aggagtaagc tccttattga agtcggagga

      541 cggagcggtg tcaagaggat attcttcgac tctgtattat agataagatg atgaggaatt

      601 ggaggtagca tagcttcatt tggatttgct ttccaggctg agactctagc ttggagcata

      661 gagggtcctt tggctttcaa tattctcaag tatctcgagt ttgaacttat tccctgtgaa

      721 ccttttattc accaatgagc attggaatga acatgaatct gaggactgca atcgccatga

      781 ggttttcgaa atacatccgg atgtcgaagg cttggggcac ctgcgttggt tgaatttaga

      841 acgtggcact attgatcatc cgatagctct gcaaagggcg ttgcacaatg caagtcaaac

      901 gttgctagca gttccaggtg gaatgttatg atgagcattg tattaaatca ggagatatag

      961 catgatctct agttagctca ccacaaaagt cagacggcgt aaccaaaagt cacacaacac

     1021 aagctgtaag gatttcggca cggctacgga agacggagaa gccaccttca gtggactcga

     1081 gtaccattta attctatttg tgtttgatcg agacctaata cagcccctac aacgaccatc

     1141 aaagtcgtat agctaccagt gaggaagtgg actcaaatcg acttcagcaa catctcctgg

     1201 ataaacttta agcctaaact atacagaata agataggtgg agagcttata ccgagctccc

     1261 aaatctgtcc agatcatggt tgaccggtgc ctggatcttc ctatagaatc atccttattc

     1321 gttgacctag ctgattctgg agtgacccag agggtcatga cttgagccta aaatccgccg

     1381 cctccaccat ttgtagaaaa atgtgacgaa ctcgtgagct ctgtacagtg accggtgact

     1441 ctttctggca tgcggagaga cggacggacg cagagagaag ggctgagtaa taagccactg

     1501 gccagacagc tctggcggct ctgaggtgca gtggatgatt attaatccgg gaccggccgc

     1561 ccctccgccc cgaagtggaa aggctggtgt gcccctcgtt gaccaagaat ctattgcatc

     1621 atcggagaat atggagcttc atcgaatcac cggcagtaag cgaaggagaa tgtgaagcca

     1681 ggggtgtata gccgtcggcg aaatagcatg ccattaacct aggtacagaa gtccaattgc

     1741 ttccgatctg gtaaaagatt cacgagatag taccttctcc gaagtaggta gagcgagtac

     1801 ccggcgcgta agctccctaa ttggcccatc cggcatctgt agggcgtcca aatatcgtgc

     1861 ctctcctgct ttgcccggtg tatgaaaccg gaaaggccgc tcaggagctg gccagcggcg

     1921 cagaccggga acacaagctg gcagtcgacc catccggtgc tctgcactcg acctgctgag

     1981 gtccctcagt ccctggtagg cagctttgcc ccgtctgtcc gcccggtgtg tcggcggggt

     2041 tgacaaggtc gttgcgtcag tccaacattt gttgccatat tttcctgctc tccccaccag

     2101 ctgctctttt cttttctctt tcttttccca tcttcagtat attcatcttc ccatccaaga

     2161 acctttattt cccctaagta agtactttgc tacatccata ctccatcctt cccatccctt

     2221 attcctttga acctttcagt tcgagctttc ccacttcatc gcagcttgac taacagctac

     2281 cccgcttgag cagacatcac catgcctgaa ctcaccgcga cgtctgtcga gaagtttctg

     2341 atcgaaaagt tcgacagcgt ctccgacctg atgcagctct cggagggcga agaatctcgt

     2401 gctttcagct tcgatgtagg agggcgtgga tatgtcctgc gggtaaatag ctgcgccgat

     2461 ggtttctaca aagatcgtta tgtttatcgg cactttgcat cggccgcgct cccgattccg

     2521 gaagtgcttg acattgggga attcagcgag agcctgacct attgcatctc ccgccgtgca

     2581 cagggtgtca cgttgcaaga cctgcctgaa accgaactgc ccgctgttct gcagccggtc

     2641 gcggaggcca tggatgcgat cgctgcggcc gatcttagcc agacgagcgg gttcggccca

     2701 ttcggaccgc aaggaatcgg tcaatacact acatggcgtg atttcatatg cgcgattgct

     2761 gatccccatg tgtatcactg gcaaactgtg atggacgaca ccgtcagtgc gtccgtcgcg

     2821 caggctctcg atgagctgat gctttgggcc gaggactgcc ccgaagtccg gcacctcgtg

     2881 cacgcggatt tcggctccaa caatgtcctg acggacaatg gccgcataac agcggtcatt

     2941 gactggagcg aggcgatgtt cggggattcc caatacgagg tcgccaacat cttcttctgg

     3001 aggccgtggt tggcttgtat ggagcagcag acgcgctact tcgagcggag gcatccggag

     3061 cttgcaggat cgccgcggct ccgggcgtat atgctccgca ttggtcttga ccaactctat

     3121 cagagcttgg ttgacggcaa tttcgatgat gcagcttggg cgcagggtcg atgcgacgca

     3181 atcgtccgat ccggagccgg gactgtcggg cgtacacaaa tcgcccgcag aagcgcggcc

     3241 gtctggaccg atggctgtgt agaagtactc gccgatagtg gaaaccgacg ccccagcact

     3301 cgtccgaggg caaaggaata gagtagatgc cgaccgcggg atccacttaa cgttactgaa

     3361 atcatcaaac agcttgacga atctggatat aagatcgttg gtgtcgatgt cagctccgga

     3421 gttgagacaa atggtgttca ggatctcgat aagatacgtt catttgtcca agcagcaaag

     3481 agtgccttct agtgatttaa tagctccatg tcaacaagaa taaaacgcgt tttcgggttt

     3541 acctcttcca gatacagctc atctgcaatg cattaatgca ttgactgcaa cctagtaacg

     3601 ccttncaggc tccggcgaag agaagaatag cttagcagag ctattttcat tttcgggaga

     3661 cgagatcaag cagatcaacg gtcgtcaaga gacctacgag actgaggaat ccgctcttgg

     3721 ctccacgcga ctatatattt gtctctaatt gtactttgac atgctcctct tctttactct

     3781 gatagcttga ctatgaaaat tccgtcacca gcncctgggt tcgcaaagat aattgcatgt

     3841 ttcttccttg aactctcaag cctacaggac acacattcat cgtaggtata aacctcgaaa

     3901 tcanttccta ctaagatggt atacaatagt aaccatgcat ggttgcctag tgaatgctcc

     3961 gtaacaccca atacgccggc cgaaactttt ttacaactct cctatgagtc gtttacccag

     4021 aatgcacagg tacacttgtt tagaggtaat ccttctttct agaagtcctc gtgtactgtg

     4081 taagcgccca ctccacatct ccactcgacc tgcaggcatg caagcttggc actggccgtc

     4141 gttttacaac gtcgtgactg ggaaaaccct ggcgttaccc aacttaatcg ccttgcagca

     4201 catccccctt tcgccagctg gcgtaatagc gaagaggccc gcaccgatcg cccttcccaa

     4261 cagttgcgca gcctgaatgg cgaatggcgc ctgatgcggt attttctcct tacgcatctg

     4321 tgcggtattt cacaccgcat atggtgcact ctcagtacaa tctgctctga tgccgcatag

     4381 ttaagccagc cccgacaccc gccaacaccc gctgacgcgc cctgacgggc ttgtctgctc

     4441 ccggcatccg cttacagaca agctgtgacc gtctccggga gctgcatgtg tcagaggttt

     4501 tcaccgtcat caccgaaacg cgcgagacga aagggcctcg tgatacgcct atttttatag

     4561 gttaatgtca tgataataat ggtttcttag acgtcaggtg gcacttttcg gggaaatgtg

     4621 cgcggaaccc ctatttgttt atttttctaa atacattcaa atatgtatcc gctcatgaga

     4681 caataaccct gataaatgct tcaataatat tgaaaaagga agagtatgag tattcaacat

     4741 ttccgtgtcg cccttattcc cttttttgcg gcattttgcc ttcctgtttt tgctcaccca

     4801 gaaacgctgg tgaaagtaaa agatgctgaa gatcagttgg gtgcacgagt gggttacatc

     4861 gaactggatc tcaacagcgg taagatcctt gagagttttc gccccgaaga acgttttcca

     4921 atgatgagca cttttaaagt tctgctatgt ggcgcggtat tatcccgtat tgacgccggg

     4981 caagagcaac tcggtcgccg catacactat tctcagaatg acttggttga gtactcacca

     5041 gtcacagaaa agcatcttac ggatggcatg acagtaagag aattatgcag tgctgccata

     5101 accatgagtg ataacactgc ggccaactta cttctgacaa cgatcggagg accgaaggag

     5161 ctaaccgctt ttttgcacaa catgggggat catgtaactc gccttgatcg ttgggaaccg

     5221 gagctgaatg aagccatacc aaacgacgag cgtgacacca cgatgcctgt agcaatggca

     5281 acaacgttgc gcaaactatt aactggcgaa ctacttactc tagcttcccg gcaacaatta

     5341 atagactgga tggaggcgga taaagttgca ggaccacttc tgcgctcggc ccttccggct

     5401 ggctggttta ttgctgataa atctggagcc ggtgagcgtg ggtctcgcgg tatcattgca

     5461 gcactggggc cagatggtaa gccctcccgt atcgtagtta tctacacgac ggggagtcag

     5521 gcaactatgg atgaacgaaa tagacagatc gctgagatag gtgcctcact gattaagcat

     5581 tggtaactgt cagaccaagt ttactcatat atactttaga ttgatttaaa acttcatttt

     5641 taatttaaaa ggatctaggt gaagatcctt tttgataatc tcatgaccaa aatcccttaa

     5701 cgtgagtttt cgttccactg agcgtcagac cccgtagaaa agatcaaagg atcttcttga

     5761 gatccttttt ttctgcgcgt aatctgctgc ttgcaaacaa aaaaaccacc gctaccagcg

     5821 gtggtttgtt tgccggatca agagctacca actctttttc cgaaggtaac tggcttcagc

     5881 agagcgcaga taccaaatac tgtccttcta gtgtagccgt agttaggcca ccacttcaag

     5941 aactctgtag caccgcctac atacctcgct ctgctaatcc tgttaccagt ggctgctgcc

     6001 agtggcgata agtcgtgtct taccgggttg gactcaagac gatagttacc ggataaggcg

     6061 cagcggtcgg gctgaacggg gggttcgtgc acacagccca gcttggagcg aacgacctac

     6121 accgaactga gatacctaca gcgtgagcta tgagaaagcg ccacgcttcc cgaagggaga

     6181 aaggcggaca ggtatccggt aagcggcagg gtcggaacag gagagcgcac gagggagctt

     6241 ccagggggaa acgcctggta tctttatagt cctgtcgggt ttcgccacct ctgacttgag

     6301 cgtcgatttt tgtgatgctc gtcagggggg cggagcctat ggaaaaacgc cagcaacgcg

     6361 gcctttttac ggttcctggc cttttgctgg ccttttgctc acatgttctt tcctgcgtta

     6421 tcccctgatt ctgtggataa ccgtattacc gcctttgagt gagctgatac cgctcgccgc

     6481 agccgaacga ccgagcgcag cgagtcagtg agcgaggaag cggaagagcg cccaatacgc

     6541 aaaccgcctc tccccgcgcg ttggccgatt cattaatgca gctggcacga caggtttccc

     6601 gactggaaag cgggcagtga gcgcaacgca attaatgtga gttagctcac tcattaggca

     6661 ccccaggctt tacactttat gcttccggct cgtatgttgt gtggaattgt gagcggataa

     6721 caatttcaca caggaaacag ctatgaccat gattac

//

 

Caution:
Product is for research use only!

 

Search name

pAN7-1,Plasmid pAN7-1,pAN7-1 vector

No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart