pAN8- 1

$396.00

  • Model: PVT5302
  • 50 Units in Stock
Ask a question


Add to Cart:

pAN8-1

PVT5302    2ug

 

pAN8-1 Information

Promoter: gpdA

Replicon: pUC ori

Terminator: TRPC

Plasmid classification: other host vectors; filamentous fungi expressing plasmids.

Plasmid size: 6089bp

Prokaryotic resistance: ampicillin Ampicillin

Screening markers: bleomycin Bleocin (Zeocin)

Cloned strain: DH5 alpha

Culture conditions: 37 centigrade, aerobic, LB

Expression host: filamentous fungi

Culture conditions: Reference Literature

Induction mode: no induction

5'sequencing primers: Based on full sequence design

3'sequencing primers: Based on full sequence design

Note: NCBI ID:Z32751.1

Use:Filamentous fungal plasmid

 

pAN8-1 Description

pAN8-1, encoding phleomycin resistance. Protoplasts of a vigorous Phleor transformant were then retransformed using the partially homologous vector, pAN7-1 which encodes hygromycin B resistance. Retransformation of this strain to hygromycin resistance occurred at frequencies that were consistently twofold higher than with the original recipient strain. Linearised pAN7-1 DNA transformed phleomycin-resistant protoplasts at higher frequencies still.

pAN8-1-vector

 

pAN8-1 Sequence

LOCUS       Exported                6089 bp ds-DNA     circular SYN 30-AUG-2016

DEFINITION  synthetic circular DNA

ACCESSION   .

VERSION     .

KEYWORDS    pAN8-1

SOURCE      synthetic DNA construct

  ORGANISM  synthetic DNA construct

REFERENCE   1  (bases 1 to 6089)

  AUTHORS   .

  TITLE     Direct Submission

  JOURNAL   Exported Tuesday, August 30, 2016 from SnapGene Viewer 3.1.4

FEATURES             Location/Qualifiers

     source          1..6089

                     /organism="synthetic DNA construct"

                     /mol_type="other DNA"

     misc_feature    1..2129

                     /note="gpdA Promoter"

     misc_feature    2178..2293

                     /note="Intron"

     CDS             2302..2676

                     /codon_start=1

                     /gene="Sh ble from Streptoalloteichus hindustanus"

                     /product="antibiotic-binding protein"

                     /note="Zeo"

                     /note="confers resistance to bleomycin, phleomycin, and 

                     Zeocin(TM)"

                     /translation="MAKLTSAVPVLTARDVAGAVEFWTDRLGFSRDFVEDDFAGVVRDD

                     VTLFISAVQDQVVPDNTLAWVWVRGLDELYAEWSEVVSTNFRDASGPAMTEIGEQPWGR

                     EFALRDPAGNCVHFVAEEQD"

     misc_feature    complement(2733..3456)

                     /note="trpC terminator"

     primer_bind     complement(3464..3480)

                     /note="M13 fwd"

                     /note="common sequencing primer, one of multiple similar 

                     variants"

     promoter        3954..4058

                     /gene="bla"

                     /note="AmpR promoter"

     CDS             4059..4919

                     /codon_start=1

                     /gene="bla"

                     /product="beta-lactamase"

                     /note="AmpR"

                     /note="confers resistance to ampicillin, carbenicillin, and

                     related antibiotics"

                     /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI

                     ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVEYS

                     PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW

                     EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA

                     LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS

                     LIKHW"

     rep_origin      5090..5678

                     /direction=RIGHT

                     /note="ori"

                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 

                     replication"

     protein_bind    5966..5987

                     /bound_moiety="E. coli catabolite activator protein"

                     /note="CAP binding site"

                     /note="CAP binding activates transcription in the presence 

                     of cAMP."

     promoter        6002..6032

                     /note="lac promoter"

                     /note="promoter for the E. coli lac operon"

     protein_bind    6040..6056

                     /bound_moiety="lac repressor encoded by lacI"

                     /note="lac operator"

                     /note="The lac repressor binds to the lac operator to 

                     inhibit transcription in E. coli. This inhibition can be 

                     relieved by adding lactose or 

                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."

     primer_bind     6064..6080

                     /note="M13 rev"

                     /note="common sequencing primer, one of multiple similar 

                     variants"

ORIGIN

        1 gaattccctt gtatctctac acacaggctc aaatcaataa gaagaacggt tcgtcttttt

       61 cgtttatatc ttgcatcgtc ccaaagctat tggcgggata ttctgtttgc agttggctga

      121 cttgaagtaa tctctgcaga tctttcgaca ctgaaatacg tcgagcctgc tccgcttgga

      181 agcggcgagg agcctcgtcc tgtcacaact accaacatgg agtacgataa gggccagttc

      241 cgccagctca ttaagagcca gttcatgggc gttggcatga tggccgtcat gcatctgtac

      301 ttcaagtaca ccaacgctct tctgatccag tcgatcatcc gctgaaggcg ctttcgaatc

      361 tggttaagat ccacgtcttc gggaagccag cgactggtga cctccagcgt ccctttaagg

      421 ctgccaacag ctttctcagc cagggccagc ccaagaccga caaggcctcc ctccagaacg

      481 ccgagaagaa ctggaggggt ggtgtcaagg aggagtaagc tccttattga agtcggagga

      541 cggagcggtg tcaagaggat attcttcgac tctgtattat agataagatg atgaggaatt

      601 ggaggtagca tagcttcatt tggatttgct ttccaggctg agactctagc ttggagcata

      661 gagggtcctt tggctttcaa tattctcaag tatctcgagt ttgaacttat tccctgtgaa

      721 ccttttattc accaatgagc attggaatga acatgaatct gaggactgca atcgccatga

      781 ggttttcgaa atacatccgg atgtcgaagg cttggggcac ctgcgttggt tgaatttaga

      841 acgtggcact attgatcatc cgatagctct gcaaagggcg ttgcacaatg caagtcaaac

      901 gttgctagca gttccaggtg gaatgttatg atgagcattg tattaaatca ggagatatag

      961 catgatctct agttagctca ccacaaaagt cagacggcgt aaccaaaagt cacacaacac

     1021 aagctgtaag gatttcggca cggctacgga agacggagaa gccaccttca gtggactcga

     1081 gtaccattta attctatttg tgtttgatcg agacctaata cagcccctac aacgaccatc

     1141 aaagtcgtat agctaccagt gaggaagtgg actcaaatcg acttcagcaa catctcctgg

     1201 ataaacttta agcctaaact atacagaata agataggtgg agagcttata ccgagctccc

     1261 aaatctgtcc agatcatggt tgaccggtgc ctggatcttc ctatagaatc atccttattc

     1321 gttgacctag ctgattctgg agtgacccag agggtcatga cttgagccta aaatccgccg

     1381 cctccaccat ttgtagaaaa atgtgacgaa ctcgtgagct ctgtacagtg accggtgact

     1441 ctttctggca tgcggagaga cggacggacg cagagagaag ggctgagtaa taagccactg

     1501 gccagacagc tctggcggct ctgaggtgca gtggatgatt attaatccgg gaccggccgc

     1561 ccctccgccc cgaagtggaa aggctggtgt gcccctcgtt gaccaagaat ctattgcatc

     1621 atcggagaat atggagcttc atcgaatcac cggcagtaag cgaaggagaa tgtgaagcca

     1681 ggggtgtata gccgtcggcg aaatagcatg ccattaacct aggtacagaa gtccaattgc

     1741 ttccgatctg gtaaaagatt cacgagatag taccttctcc gaagtaggta gagcgagtac

     1801 ccggcgcgta agctccctaa ttggcccatc cggcatctgt agggcgtcca aatatcgtgc

     1861 ctctcctgct ttgcccggtg tatgaaaccg gaaaggccgc tcaggagctg gccagcggcg

     1921 cagaccggga acacaagctg gcagtcgacc catccggtgc tctgcactcg acctgctgag

     1981 gtccctcagt ccctggtagg cagctttgcc ccgtctgtcc gcccggtgtg tcggcggggt

     2041 tgacaaggtc gttgcgtcag tccaacattt gttgccatat tttcctgctc tccccaccag

     2101 ctgctctttt cttttctctt tcttttccca tcttcagtat attcatcttc ccatccaaga

     2161 acctttattt cccctaagta agtactttgc tacatccata ctccatcctt cccatccctt

     2221 attcctttga acctttcagt tcgagctttc ccacttcatc gcagcttgac taacagctac

     2281 cccgcttgag cagacatcac catggccaag ttgaccagtg ccgttccggt gctcaccgcg

     2341 cgcgacgtcg ccggagcggt cgagttctgg accgaccggc tcgggttctc ccgggacttc

     2401 gtggaggacg acttcgccgg tgtggtccgg gacgacgtga ccctgttcat cagcgcggtc

     2461 caggaccagg tggtgccgga caacaccctg gcctgggtgt gggtgcgcgg cctggacgag

     2521 ctgtacgccg agtggtcgga ggtcgtgtcc acgaacttcc gggacgcctc cgggccggcc

     2581 atgaccgaga tcggcgagca gccgtggggg cgggagttcg ccctgcgcga cccggccggc

     2641 aactgcgtgc acttcgtggc cgaggagcag gactgaccga cgccgaccaa caccgccggt

     2701 ccgacggcgg cccacgggtc ccaggagctt gagatccact taacgttact gaaatcatca

     2761 aacagcttga cgaatctgga tataagatcg ttggtgtcga tgtcagctcc ggagttgaga

     2821 caaatggtgt tcaggatctc gataagatac gttcatttgt ccaagcagca aagagtgcct

     2881 tctagtgatt taatagctcc atgtcaacaa gaataaaacg cgttttcggg tttacctctt

     2941 ccagatacag ctcatctgca atgcattaat gcattgactg caacctagta acgccttnca

     3001 ggctccggcg aagagaagaa tagcttagca gagctatttt cattttcggg agacgagatc

     3061 aagcagatca acggtcgtca agagacctac gagactgagg aatccgctct tggctccacg

     3121 cgactatata tttgtctcta attgtacttt gacatgctcc tcttctttac tctgatagct

     3181 tgactatgaa aattccgtca ccagcncctg ggttcgcaaa gataattgca tgtttcttcc

     3241 ttgaactctc aagcctacag gacacacatt catcgtaggt ataaacctcg aaatcanttc

     3301 ctactaagat ggtatacaat agtaaccatg catggttgcc tagtgaatgc tccgtaacac

     3361 ccaatacgcc ggccgaaact tttttacaac tctcctatga gtcgtttacc cagaatgcac

     3421 aggtacactt gtttagaggt aatccttctt tctagagctt ggcactggcc gtcgttttac

     3481 aacgtcgtga ctgggaaaac cctggcgtta cccaacttaa tcgccttgca gcacatcccc

     3541 ctttcgccag ctggcgtaat agcgaagagg cccgcaccga tcgcccttcc caacagttgc

     3601 gcagcctgaa tggcgaatgg cgcctgatgc ggtattttct ccttacgcat ctgtgcggta

     3661 tttcacaccg catatggtgc actctcagta caatctgctc tgatgccgca tagttaagcc

     3721 agccccgaca cccgccaaca cccgctgacg cgccctgacg ggcttgtctg ctcccggcat

     3781 ccgcttacag acaagctgtg accgtctccg ggagctgcat gtgtcagagg ttttcaccgt

     3841 catcaccgaa acgcgcgaga cgaaagggcc tcgtgatacg cctattttta taggttaatg

     3901 tcatgataat aatggtttct tagacgtcag gtggcacttt tcggggaaat gtgcgcggaa

     3961 cccctatttg tttatttttc taaatacatt caaatatgta tccgctcatg agacaataac

     4021 cctgataaat gcttcaataa tattgaaaaa ggaagagtat gagtattcaa catttccgtg

     4081 tcgcccttat tccctttttt gcggcatttt gccttcctgt ttttgctcac ccagaaacgc

     4141 tggtgaaagt aaaagatgct gaagatcagt tgggtgcacg agtgggttac atcgaactgg

     4201 atctcaacag cggtaagatc cttgagagtt ttcgccccga agaacgtttt ccaatgatga

     4261 gcacttttaa agttctgcta tgtggcgcgg tattatcccg tattgacgcc gggcaagagc

     4321 aactcggtcg ccgcatacac tattctcaga atgacttggt tgagtactca ccagtcacag

     4381 aaaagcatct tacggatggc atgacagtaa gagaattatg cagtgctgcc ataaccatga

     4441 gtgataacac tgcggccaac ttacttctga caacgatcgg aggaccgaag gagctaaccg

     4501 cttttttgca caacatgggg gatcatgtaa ctcgccttga tcgttgggaa ccggagctga

     4561 atgaagccat accaaacgac gagcgtgaca ccacgatgcc tgtagcaatg gcaacaacgt

     4621 tgcgcaaact attaactggc gaactactta ctctagcttc ccggcaacaa ttaatagact

     4681 ggatggaggc ggataaagtt gcaggaccac ttctgcgctc ggcccttccg gctggctggt

     4741 ttattgctga taaatctgga gccggtgagc gtgggtctcg cggtatcatt gcagcactgg

     4801 ggccagatgg taagccctcc cgtatcgtag ttatctacac gacggggagt caggcaacta

     4861 tggatgaacg aaatagacag atcgctgaga taggtgcctc actgattaag cattggtaac

     4921 tgtcagacca agtttactca tatatacttt agattgattt aaaacttcat ttttaattta

     4981 aaaggatcta ggtgaagatc ctttttgata atctcatgac caaaatccct taacgtgagt

     5041 tttcgttcca ctgagcgtca gaccccgtag aaaagatcaa aggatcttct tgagatcctt

     5101 tttttctgcg cgtaatctgc tgcttgcaaa caaaaaaacc accgctacca gcggtggttt

     5161 gtttgccgga tcaagagcta ccaactcttt ttccgaaggt aactggcttc agcagagcgc

     5221 agataccaaa tactgtcctt ctagtgtagc cgtagttagg ccaccacttc aagaactctg

     5281 tagcaccgcc tacatacctc gctctgctaa tcctgttacc agtggctgct gccagtggcg

     5341 ataagtcgtg tcttaccggg ttggactcaa gacgatagtt accggataag gcgcagcggt

     5401 cgggctgaac ggggggttcg tgcacacagc ccagcttgga gcgaacgacc tacaccgaac

     5461 tgagatacct acagcgtgag ctatgagaaa gcgccacgct tcccgaaggg agaaaggcgg

     5521 acaggtatcc ggtaagcggc agggtcggaa caggagagcg cacgagggag cttccagggg

     5581 gaaacgcctg gtatctttat agtcctgtcg ggtttcgcca cctctgactt gagcgtcgat

     5641 ttttgtgatg ctcgtcaggg gggcggagcc tatggaaaaa cgccagcaac gcggcctttt

     5701 tacggttcct ggccttttgc tggccttttg ctcacatgtt ctttcctgcg ttatcccctg

     5761 attctgtgga taaccgtatt accgcctttg agtgagctga taccgctcgc cgcagccgaa

     5821 cgaccgagcg cagcgagtca gtgagcgagg aagcggaaga gcgcccaata cgcaaaccgc

     5881 ctctccccgc gcgttggccg attcattaat gcagctggca cgacaggttt cccgactgga

     5941 aagcgggcag tgagcgcaac gcaattaatg tgagttagct cactcattag gcaccccagg

     6001 ctttacactt tatgcttccg gctcgtatgt tgtgtggaat tgtgagcgga taacaatttc

     6061 acacaggaaa cagctatgac catgattac

//

 

Search name

pAN8-1,Plasmid pAN8-1,pAN8-1 vector

No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart