pART27

$260.00

  • Model: PVT11364
  • 50 Units in Stock
Ask a question


Add to Cart:

pART27

Catalog No. PVT11364
Packing 2ug

 

pART27 Information

Function /
Resistance Str
Screen G418
Strain DH5α
Culture temperature  LB 37℃
Copy Number:  Low copy
Remark  Plasmid Maxi Preparation

 

pART27 Descrption

PART27 is a Bacillus plasmid.

 

pART27 Sequence

LOCUS       Exported               11667 bp ds-DNA     circular SYN 20-JUN-2018

DEFINITION  synthetic circular DNA

ACCESSION   .

VERSION     .

KEYWORDS    pART27

SOURCE      synthetic DNA construct

  ORGANISM  synthetic DNA construct

REFERENCE   1  (bases 1 to 11667)

  AUTHORS   .

  TITLE     Direct Submission

FEATURES             Location/Qualifiers

     source          1..11667

                     /organism="synthetic DNA construct"

                     /mol_type="other DNA"

     misc_feature    477..501

                     /note="RB T-DNA repeat"

                     /note="right border repeat from nopaline C58 T-DNA"

     promoter        793..823

                     /note="lac promoter"

                     /note="promoter for the E. coli lac operon"

     CDS             867..1217

                     /codon_start=1

                     /gene="lacZ fragment"

                     /product="LacZ-alpha fragment of beta-galactosidase"

                     /note="lacZ-alpha"

                     /translation="MTMITPSYLGDTIEYSSYASNALGALPYRPAGGRTSDIPRPWRPG

                     ACDVGPNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS

                     QQLRSLNGEWKL"

     promoter        889..907

                     /note="SP6 promoter"

                     /note="promoter for bacteriophage SP6 RNA polymerase"

     misc_feature    925..1019

                     /note="MCS"

     promoter        complement(1027..1045)

                     /note="T7 promoter"

                     /note="promoter for bacteriophage T7 RNA polymerase"

     promoter        1226..1409

                     /function="NOS promoter"

                     /note="NOS promoter"

                     /note="nopaline synthase promoter"

     CDS             1410..2231

                     /codon_start=1

                     /gene="nos-nptII"

                     /product="fusion between an N-terminal peptide of nopaline 

                     synthase and Tn5 aminoglycoside phosphotransferase"

                     /note="KanR"

                     /note="confers resistance to kanamycin"

                     /translation="MAITLSATSLPISARIRAGSPAAWVERLFGYDWAQQTIGCSDAAV

                     FRLSAQGRPVLFVKTDLSGALNELQDEAARLSWLATTGVPCAAVLDVVTEAGRDWLLLG

                     EVPGQDLLSSHLAPAEKVSIMADAMRRLHTLDPATCPFDHQAKHRIERARTRMEAGLVD

                     QDDLDEEHQGLAPAELFARLKARMPDGEDLVVTHGDACLPNIMVENGRFSGFIDCGRLG

                     VADRYQDIALATRDIAEELGGEWADRFLVLYGIAAPDSQRIAFYRLLDEFF"

     terminator      2856..3108

                     /note="NOS terminator"

                     /note="nopaline synthase terminator and poly(A) signal"

     misc_feature    3230..3254

                     /note="LB T-DNA repeat"

                     /note="left border repeat from nopaline C58 T-DNA"

     oriT            3808..3917

                     /note="incP origin of transfer"

     mobile_element  3977..4744

                     /mobile_element_type="insertion sequence:IS1"

                     /note="IS1"

                     /note="prokaryotic transposable element"

     CDS             5369..6517

                     /codon_start=1

                     /product="trans-acting replication protein that binds to 

                     and activates oriV"

                     /note="trfA"

                     /translation="MNRTFDRKAYRQELIDAGFSAEDAETIASRTVMRAPRETFQSVGS

                     MVQQATAKIERDSVQLAPPALPAPSAAVERSRRLEQEAAGLAKSMTIDTRGTMTTKKRK

                     TAGEDLAKQVSEAKQAALLKHTKQQIKEMQLSLFDIAPWPDTMRAMPNDTARSALFTTR

                     NKKIPREALQNKVIFHVNKDVKITYTGVELRADDDELVWQQVLEYAKRTPIGEPITFTF

                     YELCQDLGWSINGRYYTKAEECLSRLQATAMGFTSDRVGHLESVSLLHRFRVLDRGKKT

                     SRCQVLIDEEIVVLFAGDHYTKFIWEKYRKLSPTARRMFDYFSSHREPYPLKLETFRLM

                     CGSDSTRVKKWREQVGEACEELRGSGLVEHAWVNDDLVHCKR"

     rep_origin      complement(7877..8465)

                     /direction=LEFT

                     /note="ori"

                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 

                     replication"

     CDS             9562..10350

                     /codon_start=1

                     /gene="aadA"

                     /product="aminoglycoside adenylyltransferase (Murphy, 

                     1985)"

                     /note="Spe"

                     /note="confers resistance to spectinomycin and 

                     streptomycin"

                     /translation="MREAVIAEVSTQLSEVVGVIERHLEPTLLAVHLYGSAVDGGLKPH

                     SDIDLLVTVTVRLDETTRRALINDLLETSASPGESEILRAVEVTIVVHDDIIPWRYPAK

                     RELQFGEWQRNDILAGIFEPATIDIDLAILLTKAREHSVALVGPAAEELFDPVPEQDLF

                     EALNETLTLWNSPPDWAGDERNVVLTLSRIWYSAVTGKIAPKDVAADWAMERLPAQYQP

                     VILEARQAYLGQEDRLASRADQLEEFVHYVKGEITKVVGK"

     rep_origin      11033..11646

                     /note="oriV"

                     /note="origin of replication for the bacterial F plasmid"

ORIGIN

        1 tcgacatctt gctgcgttcg gatattttcg tggagttccc gccacagacc cggattgaag

       61 gcgagatcca gcaactcgcg ccagatcatc ctgtgacgga actttggcgc gtgatgactg

      121 gccaggacgt cggccgaaag agcgacaagc agatcacgat tttcgacagc gtcggatttg

      181 cgatcgagga tttttcggcg ctgcgctacg tccgcgaccg cgttgaggga tcaagccaca

      241 gcagcccact cgaccttcta gccgacccag acgagccaag ggatcttttt ggaatgctgc

      301 tccgtcgtca ggctttccga cgtttgggtg gttgaacaga agtcattatc gtacggaatg

      361 ccagcactcc cgaggggaac cctgtggttg gcatgcacat acaaatggac gaacggataa

      421 accttttcac gcccttttaa atatccgtta ttctaataaa cgctcttttc tcttaggttt

      481 acccgccaat atatcctgtc aaacactgat agtttaaact gaaggcggga aacgacaatc

      541 tgatcatgag cggagaatta agggagtcac gttatgaccc ccgccgatga cgcgggacaa

      601 gccgttttac gtttggaact gacagaaccg caacgattga aggagccact cagccccaat

      661 acgcaaaccg cctctccccg cgcgttggcc gattcattaa tgcagctggc acgacaggtt

      721 tcccgactgg aaagcgggca gtgagcgcaa cgcaattaat gtgagttagc tcactcatta

      781 ggcaccccag gctttacact ttatgcttcc ggctcgtatg ttgtgtggaa ttgtgagcgg

      841 ataacaattt cacacaggaa acagctatga ccatgattac gccaagctat ttaggtgaca

      901 ctatagaata ctcaagctat gcatccaacg cgttgggagc tctcccatat cgacctgcag

      961 gcggccgcac tagtgatatc ccgcggccat ggcggccggg agcatgcgac gtcgggccca

     1021 attcgcccta tagtgagtcg tattacaatt cactggccgt cgttttacaa cgtcgtgact

     1081 gggaaaaccc tggcgttacc caacttaatc gccttgcagc acatccccct ttcgccagct

     1141 ggcgtaatag cgaagaggcc cgcaccgatc gcccttccca acagttgcgc agcctgaatg

     1201 gcgaatggaa attgtaaacg ttaatgggtt tctggagttt aatgagctaa gcacatacgt

     1261 cagaaaccat tattgcgcgt tcaaaagtcg cctaaggtca ctatcagcta gcaaatattt

     1321 cttgtcaaaa atgctccact gacgttccat aaattcccct cggtatccaa ttagagtctc

     1381 atattcactc tcaatccaaa taatctgcaa tggcaattac cttatccgca acttctttac

     1441 ctatttccgc ccggatccgg gcaggttctc cggccgcttg ggtggagagg ctattcggct

     1501 atgactgggc acaacagaca atcggctgct ctgatgccgc cgtgttccgg ctgtcagcgc

     1561 aggggcgccc ggttcttttt gtcaagaccg acctgtccgg tgccctgaat gaactgcagg

     1621 acgaggcagc gcggctatcg tggctggcca cgacgggcgt tccttgcgca gctgtgctcg

     1681 acgttgtcac tgaagcggga agggactggc tgctattggg cgaagtgccg gggcaggatc

     1741 tcctgtcatc tcaccttgct cctgccgaga aagtatccat catggctgat gcaatgcggc

     1801 ggctgcatac gcttgatccg gctacctgcc cattcgacca ccaagcgaaa catcgcatcg

     1861 agcgagcacg tactcggatg gaagccggtc ttgtcgatca ggatgatctg gacgaagagc

     1921 atcaggggct cgcgccagcc gaactgttcg ccaggctcaa ggcgcgcatg cccgacggcg

     1981 aggatctcgt cgtgacccat ggcgatgcct gcttgccgaa tatcatggtg gaaaatggcc

     2041 gcttttctgg attcatcgac tgtggccggc tgggtgtggc ggaccgctat caggacatag

     2101 cgttggctac ccgtgatatt gctgaagagc ttggcggcga atgggctgac cgcttcctcg

     2161 tgctttacgg tatcgccgct cccgattcgc agcgcatcgc cttctatcgc cttcttgacg

     2221 agttcttctg agcgggactc tggggttcga aatgaccgac caagcgacgc ccaacctgcc

     2281 atcacgagat ttcgattcca ccgccgcctt ctatgaaagg ttgggcttcg gaatcgtttt

     2341 ccgggacgcc ggctggatga tcctccagcg cggggatctc atgctggagt tcttcgccca

     2401 ccccgatcca acacttacgt ttgcaacgtc caagagcaaa tagaccacga acgccggaag

     2461 gttgccgcag cgtgtggatt gcgtctcaat tctctcttgc aggaatgcaa tgatgaatat

     2521 gatactgact atgaaacttt gagggaatac tgcctagcac cgtcacctca taacgtgcat

     2581 catgcatgcc ctgacaacat ggaacatcgc tatttttctg aagaattatg ctcgttggag

     2641 gatgtcgcgg caattgcagc tattgccaac atcgaactac ccctcacgca tgcattcatc

     2701 aatattattc atgcggggaa aggcaagatt aatccaactg gcaaatcatc cagcgtgatt

     2761 ggtaacttca gttccagcga cttgattcgt tttggtgcta cccacgtttt caataaggac

     2821 gagatggtgg agtaaagaag gagtgcgtcg aagcagatcg ttcaaacatt tggcaataaa

     2881 gtttcttaag attgaatcct gttgccggtc ttgcgatgat tatcatataa tttctgttga

     2941 attacgttaa gcatgtaata attaacatgt aatgcatgac gttatttatg agatgggttt

     3001 ttatgattag agtcccgcaa ttatacattt aatacgcgat agaaaacaaa atatagcgcg

     3061 caaactagga taaattatcg cgcgcggtgt catctatgtt actagatcga attaattcca

     3121 ggcggtgaag ggcaatcagc tgttgcccgt ctcactggtg aaaagaaaaa ccaccccagt

     3181 acattaaaaa cgtccgcaat gtgttattaa gttgtctaag cgtcaatttg tttacaccac

     3241 aatatatcct gccaccagcc agccaacagc tccccgaccg gcagctcggc acaaaatcac

     3301 cactcgatac aggcagccca tcagtccggg acggcgtcag cgggagagcc gttgtaaggc

     3361 ggcagacttt gctcatgtta ccgatgctat tcggaagaac ggcaactaag ctgccgggtt

     3421 tgaaacacgg atgatctcgc ggagggtagc atgttgattg taacgatgac agagcgttgc

     3481 tgcctgtgat caaatatcat ctccctcgca gagatccgaa ttatcagcct tcttattcat

     3541 ttctcgctta accgtgacag gctgtcgatc ttgagaacta tgccgacata ataggaaatc

     3601 gctggataaa gccgctgagg aagctgagtg gcgctatttc tttagaagtg aacgttgacg

     3661 atgtcgacgg atcttttccg ctgcataacc ctgcttcggg gtcattatag cgattttttc

     3721 ggtatatcca tcctttttcg cacgatatac aggattttgc caaagggttc gtgtagactt

     3781 tccttggtgt atccaacggc gtcagccggg caggataggt gaagtaggcc cacccgcgag

     3841 cgggtgttcc ttcttcactg tcccttattc gcacctggcg gtgctcaacg ggaatcctgc

     3901 tctgcgaggc tggccggcta ccgccggcgt aacagatgag ggcaagcgga tggctgatga

     3961 aaccaagcca accaggggtg atgctgccaa cttactgatt tagtgtatga tggtgttttt

     4021 gaggtgctcc agtggcttct gtttctatca gctgtccctc ctgttcagct actgacgggg

     4081 tggtgcgtaa cggcaaaagc accgccggac atcagcgcta tctctgctct cactgccgta

     4141 aaacatggca actgcagttc acttacaccg cttctcaacc cggtacgcac cagaaaatca

     4201 ttgatatggc catgaatggc gttggatgcc gggcaacagc ccgcattatg ggcgttggcc

     4261 tcaacacgat tttacgtcac ttaaaaaact caggccgcag tcggtaacct cgcgcataca

     4321 gccgggcagt gacgtcatcg tctgcgcgga aatggacgaa cagtggggct atgtcggggc

     4381 taaatcgcgc cagcgctggc tgttttacgc gtatgacagt ctccggaaga cggttgttgc

     4441 gcacgtattc ggtgaacgca ctatggcgac gctggggcgt cttatgagcc tgctgtcacc

     4501 ctttgacgtg gtgatatgga tgacggatgg ctggccgctg tatgaatccc gcctgaaggg

     4561 aaagctgcac gtaatcagca agcgatatac gcagcgaatt gagcggcata acctgaatct

     4621 gaggcagcac ctggcacggc tgggacggaa gtcgctgtcg ttctcaaaat cggtggagct

     4681 gcatgacaaa gtcatcgggc attatctgaa cataaaacac tatcaataag ttggagtcat

     4741 tacccaacca ggaagggcag cccacctatc aaggtgtact gccttccaga cgaacgaaga

     4801 gcgattgagg aaaaggcggc ggcggccggc atgagcctgt cggcctacct gctggccgtc

     4861 ggccagggct acaaaatcac gggcgtcgtg gactatgagc acgtccgcga gctggcccgc

     4921 atcaatggcg acctgggccg cctgggcggc ctgctgaaac tctggctcac cgacgacccg

     4981 cgcacggcgc ggttcggtga tgccacgatc ctcgccctgc tggcgaagat cgaagagaag

     5041 caggacgagc ttggcaaggt catgatgggc gtggtccgcc cgagggcaga gccatgactt

     5101 ttttagccgc taaaacggcc ggggggtgcg cgtgattgcc aagcacgtcc ccatgcgctc

     5161 catcaagaag agcgacttcg cggagctggt attcgtgcag ggcaagattc ggaataccaa

     5221 gtacgagaag gacggccaga cggtctacgg gaccgacttc attgccgata aggtggatta

     5281 tctggacacc aaggcaccag gcgggtcaaa tcaggaataa gggcacattg ccccggcgtg

     5341 agtcggggca atcccgcaag gagggtgaat gaatcggacg tttgaccgga aggcatacag

     5401 gcaagaactg atcgacgcgg ggttttccgc cgaggatgcc gaaaccatcg caagccgcac

     5461 cgtcatgcgt gcgccccgcg aaaccttcca gtccgtcggc tcgatggtcc agcaagctac

     5521 ggccaagatc gagcgcgaca gcgtgcaact ggctccccct gccctgcccg cgccatcggc

     5581 cgccgtggag cgttcgcgtc gtctcgaaca ggaggcggca ggtttggcga agtcgatgac

     5641 catcgacacg cgaggaacta tgacgaccaa gaagcgaaaa accgccggcg aggacctggc

     5701 aaaacaggtc agcgaggcca agcaggccgc gttgctgaaa cacacgaagc agcagatcaa

     5761 ggaaatgcag ctttccttgt tcgatattgc gccgtggccg gacacgatgc gagcgatgcc

     5821 aaacgacacg gcccgctctg ccctgttcac cacgcgcaac aagaaaatcc cgcgcgaggc

     5881 gctgcaaaac aaggtcattt tccacgtcaa caaggacgtg aagatcacct acaccggcgt

     5941 cgagctgcgg gccgacgatg acgaactggt gtggcagcag gtgttggagt acgcgaagcg

     6001 cacccctatc ggcgagccga tcaccttcac gttctacgag ctttgccagg acctgggctg

     6061 gtcgatcaat ggccggtatt acacgaaggc cgaggaatgc ctgtcgcgcc tacaggcgac

     6121 ggcgatgggc ttcacgtccg accgcgttgg gcacctggaa tcggtgtcgc tgctgcaccg

     6181 cttccgcgtc ctggaccgtg gcaagaaaac gtcccgttgc caggtcctga tcgacgagga

     6241 aatcgtcgtg ctgtttgctg gcgaccacta cacgaaattc atatgggaga agtaccgcaa

     6301 gctgtcgccg acggcccgac ggatgttcga ctatttcagc tcgcaccggg agccgtaccc

     6361 gctcaagctg gaaaccttcc gcctcatgtg cggatcggat tccacccgcg tgaagaagtg

     6421 gcgcgagcag gtcggcgaag cctgcgaaga gttgcgaggc agcggcctgg tggaacacgc

     6481 ctgggtcaat gatgacctgg tgcattgcaa acgctagggc cttgtggggt cagttccggc

     6541 tgggggttca gcagccagcg ctttactggc atttcaggaa caagcgggca ctgctcgacg

     6601 cacttgcttc gctcagtatc gctcgggacg cacggcgcgc tctacgaact gccgataaac

     6661 agaggattaa aattgacaat tgtgattaag gctcagattc gacggcttgg agcggccgac

     6721 gtgcaggatt tccgcgagat ccgattgtcg gccctgaaga aagctccaga gatgttcggg

     6781 tccgtttacg agcacgagga gaaaaagccc atggaggcgt tcgctgaacg gttgcgagat

     6841 gccgtggcat tcggcgccta catcgacggc gagatcattg ggctgtcggt cttcaaacag

     6901 gaggacggcc ccaaggacgc tcacaaggcg catctgtccg gcgttttcgt ggagcccgaa

     6961 cagcgaggcc gaggggtcgc cggtatgctg ctgcgggcgt tgccggcggg tttattgctc

     7021 gtgatgatcg tccgacagat tccaacggga atctggtgga tgcgcatctt catcctcggc

     7081 gcacttaata tttcgctatt ctggagcttg ttgtttattt cggtctaccg cctgccgggc

     7141 ggggtcgcgg cgacggtagg cgctgtgcag ccgctgatgg tcgtgttcat ctctgccgct

     7201 ctgctaggta gcccgatacg attgatggcg gtcctggggg ctatttgcgg aactgcgggc

     7261 gtggcgctgt tggtgttgac accaaacgca gcgctagatc ctgtcggcgt cgcagcgggc

     7321 ctggcggggg cggtttccat ggcgttcgga accgtgctga cccgcaagtg gcaacctccc

     7381 gtgcctctgc tcacctttac cgcctggcaa ctggcggccg gaggacttct gctcgttcca

     7441 gtagctttag tgtttgatcc gccaatcccg atgcctacag gaaccaatgt tctcggcctg

     7501 gcgtggctcg gcctgatcgg agcgggttta acctacttcc tttggttccg ggggatctcg

     7561 cgactcgaac ctacagttgt ttccttactg ggctttctca gccgggatgg cgctaagaag

     7621 ctattgccgc cgatcttcat atgcggtgtg aaataccgca cagatgcgta aggagaaaat

     7681 accgcatcag gcgctcttcc gcttcctcgc tcactgactc gctgcgctcg gtcgttcggc

     7741 tgcggcgagc ggtatcagct cactcaaagg cggtaatacg gttatccaca gaatcagggg

     7801 ataacgcagg aaagaacatg tgagcaaaag gccagcaaaa ggccaggaac cgtaaaaagg

     7861 ccgcgttgct ggcgtttttc cataggctcc gcccccctga cgagcatcac aaaaatcgac

     7921 gctcaagtca gaggtggcga aacccgacag gactataaag ataccaggcg tttccccctg

     7981 gaagctccct cgtgcgctct cctgttccga ccctgccgct taccggatac ctgtccgcct

     8041 ttctcccttc gggaagcgtg gcgctttctc aatgctcacg ctgtaggtat ctcagttcgg

     8101 tgtaggtcgt tcgctccaag ctgggctgtg tgcacgaacc ccccgttcag cccgaccgct

     8161 gcgccttatc cggtaactat cgtcttgagt ccaacccggt aagacacgac ttatcgccac

     8221 tggcagcagc cactggtaac aggattagca gagcgaggta tgtaggcggt gctacagagt

     8281 tcttgaagtg gtggcctaac tacggctaca ctagaaggac agtatttggt atctgcgctc

     8341 tgctgaagcc agttaccttc ggaaaaagag ttggtagctc ttgatccggc aaacaaacca

     8401 ccgctggtag cggtggtttt tttgtttgca agcagcagat tacgcgcaga aaaaaaggat

     8461 atcaagaaga tcctttgatc ttttctacgg ggtctgacgc tcagtggaac gaaaactcac

     8521 gttaagggat tttggtcatg agattatcaa aaaggatctt cacctagatc cttttaaatt

     8581 aaaaatgaag ttttaaatca atctaaagta tatatgagta aacttggtct gacagttacc

     8641 aatgcttaat cagtgaggca cctatctcag cgatctgtct atttcgttca tccatagttg

     8701 cctgactccc cgtcgtgtag ataactacga tacgggaggg cttaccatct ggccccagtg

     8761 ctgcaatgat accgcgagac ccacgctcac cggctccaga tttatcagca ataaaccagc

     8821 cagccggaag ggccgagcgc agaagtggtc ctgcaacttt atccgcctcc atccagtcta

     8881 ttaaacaagt ggcagcaacg gattcgcaaa cctgtcacgc cttttgtgcc aaaagccgcg

     8941 ccaggtttgc gatccgctgt gccaggcgtt aggcgtcata tgaagatttc ggtgatccct

     9001 gagcaggtgg cggaaacatt ggatgctgag aaccatttca ttgttcgtga agtgttcgat

     9061 gtgcacctat ccgaccaagg ctttgaacta tctaccagaa gtgtgagccc ctaccggaag

     9121 gattacatct cggatgatga ctctgatgaa gactctgctt gctatggcgc attcatcgac

     9181 caagagcttg tcgggaagat tgaactcaac tcaacatgga acgatctagc ctctatcgaa

     9241 cacattgttg tgtcgcacac gcaccgaggc aaaggagtcg cgcacagtct catcgaattt

     9301 gcgaaaaagt gggcactaag cagacagctc cttggcatac gattagagac acaaacgaac

     9361 aatgtacctg cctgcaattt gtacgcaaaa tgtggcttta ctctcggcgg cattgacctg

     9421 ttcacgtata aaactagacc tcaagtctcg aacgaaacag cgatgtactg gtactggttc

     9481 tcgggagcac aggatgacgc ctaacaattc attcaagccg acaccgcttc gcggcgcggc

     9541 ttaattcagg agttaaacat catgagggaa gcggtgatcg ccgaagtatc gactcaacta

     9601 tcagaggtag ttggcgtcat cgagcgccat ctcgaaccga cgttgctggc cgtacatttg

     9661 tacggctccg cagtggatgg cggcctgaag ccacacagtg atattgattt gctggttacg

     9721 gtgaccgtaa ggcttgatga aacaacgcgg cgagctttga tcaacgacct tttggaaact

     9781 tcggcttccc ctggagagag cgagattctc cgcgctgtag aagtcaccat tgttgtgcac

     9841 gacgacatca ttccgtggcg ttatccagct aagcgcgaac tgcaatttgg agaatggcag

     9901 cgcaatgaca ttcttgcagg tatcttcgag ccagccacga tcgacattga tctggctatc

     9961 ttgctgacaa aagcaagaga acatagcgtt gccttggtag gtccagcggc ggaggaactc

    10021 tttgatccgg ttcctgaaca ggatctattt gaggcgctaa atgaaacctt aacgctatgg

    10081 aactcgccgc ccgactgggc tggcgatgag cgaaatgtag tgcttacgtt gtcccgcatt

    10141 tggtacagcg cagtaaccgg caaaatcgcg ccgaaggatg tcgctgccga ctgggcaatg

    10201 gagcgcctgc cggcccagta tcagcccgtc atacttgaag ctaggcaggc ttatcttgga

    10261 caagaagatc gcttggcctc gcgcgcagat cagttggaag aatttgttca ctacgtgaaa

    10321 ggcgagatca ccaaggtagt cggcaaataa tgtctaacaa ttcgttcaag ccgacgccgc

    10381 ttcgcggcgc ggcttaactc aagcgttaga gagctgggga agactatgcg cgatctgttg

    10441 aaggtggttc taagcctcgt acttgcgatg gcatcggggc aggcacttgc tgacctgcca

    10501 attgttttag tggatgaagc tcgtcttccc tatgactact ccccatccaa ctacgacatt

    10561 tctccaagca actacgacaa ctccataagc aattacgaca atagtccatc aaattacgac

    10621 aactctgaga gcaactacga taatagttca tccaattacg acaatagtcg caacggaaat

    10681 cgtaggctta tatatagcgc aaatgggtct cgcactttcg ccggctacta cgtcattgcc

    10741 aacaatggga caacgaactt cttttccaca tctggcaaaa ggatgttcta caccccaaaa

    10801 ggggggcgcg gcgtctatgg cggcaaagat gggagcttct gcggggcatt ggtcgtcata

    10861 aatggccaat tttcgcttgc cctgacagat aacggcctga agatcatgta tctaagcaac

    10921 tagcctgctc tctaataaaa tgttaggagc ttggctgcca tttttggggt gaggccgttc

    10981 gcggccgagg ggcgcagccc ctggggggat gggaggcccg cgttagcggg ccgggagggt

    11041 tcgagaaggg ggggcacccc ccttcggcgt gcgcggtcac gcgccagggc gcagccctgg

    11101 ttaaaaacaa ggtttataaa tattggttta aaagcaggtt aaaagacagg ttagcggtgg

    11161 ccgaaaaacg ggcggaaacc cttgcaaatg ctggattttc tgcctgtgga cagcccctca

    11221 aatgtcaata ggtgcgcccc tcatctgtca gcactctgcc cctcaagtgt caaggatcgc

    11281 gcccctcatc tgtcagtagt cgcgcccctc aagtgtcaat accgcagggc acttatcccc

    11341 aggcttgtcc acatcatctg tgggaaactc gcgtaaaatc aggcgttttc gccgatttgc

    11401 gaggctggcc agctccacgt cgccggccga aatcgagcct gcccctcatc tgtcaacgcc

    11461 gcgccgggtg agtcggcccc tcaagtgtca acgtccgccc ctcatctgtc agtgagggcc

    11521 aagttttccg cgaggtatcc acaacgccgg cggccggccg cggtgtctcg cacacggctt

    11581 cgacggcgtt tctggcgcgt ttgcagggcc atagacggcc gccagcccag cggcgagggc

    11641 aaccagcccg gtgagcgtcg gaaaggg

//

 

Caution

Product is for research use only!

 

No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart