pBABE- Puro SV40 LT

$215.00

  • Model: PVT10529
  • 50 Units in Stock
Ask a question


Add to Cart:

pBABE-Puro SV40 LT

Catalog No. PVT10529
Packing 2ug

 

pBABE-Puro SV40 LT Information

Function Other source plasmids

Plasmid classification: gene library plasmid; other gene plasmids; other source plasmids.

Plasmid size: 7273bp

Prokaryotic resistance: ampicillin Amp (100 u g/ml)

Screening markers: purinomycin Puro

Cloned strains of Escherichia coli, Stbl3 and other Escherichia coli

Culture conditions: 37 centigrade, aerobic, LB

Expression host: mammalian cells such as 293T

Induction mode: no induction

Note: low copy

 

pBABE-Puro SV40 LT Description

PBABE-Puro SV40 LT plasmid reference: https://www.ncbi.nlm.nih.gov/pubmed/12781366

 

pBABE-Puro SV40 LT Sequence

LOCUS       Exported                7273 bp ds-DNA     circular SYN 15-AUG-2017

DEFINITION  synthetic circular DNA

KEYWORDS    pBABE-Puro SV40 LT.dna

FEATURES             Location/Qualifiers

     source          1..7273

                     /organism="synthetic DNA construct"

                     /mol_type="other DNA"

     LTR             12..481

                     /note="long terminal repeat from Moloney murine leukemia 

                     virus"

     misc_feature    546..745

                     /label=MMLV Psi

                     /note="packaging signal of Moloney murine leukemia virus 

                     (MMLV)"

     CDS             946..1362

                     /label=gag (truncated)

                     /note="truncated Moloney murine leukemia virus (MMLV) gag 

                     gene lacking the start codon"

     CDS             1400..3526

                     /codon_start=1

                     /product="Simian virus-40 large-T antigen

                     AF316141"

                     /label=SV40 LT

                     /translation="MDKVLNREESLQLMDLLGLERSAWGNIPLMRKAYLKKCKEFHPDK

                     GGDEEKMKKMNTLYKKMEDGVKYAHQPDFGGFWDATEIPTYGTDEWEQWWNAFNEENLF

                     CSEEMPSSDDEATADSQHSTPPKKKRKVEDPKDFPSELLSFLSHAVFSNRTLACFAIYT

                     TKEKAALLYKKIMEKYSVTFISRHNSYNHNILFFLTPHRHRVSAINNYAQKLCTFSFLI

                     CKGVNKEYLMYSALTRDPFSVIEESLPGGLKEHDFNPEEAEETKQVSWKLVTEYAMETK

                     CDDVLLLLGMYLEFQYSFEMCLKCIKKEQPSHYKYHEKHYANAAIFADSKNQKTICQQA

                     VDTVLAKKRVDSLQLTREQMLTNRFNDLLDRMDIMFGSTGSADIEEWMAGVAWLHCLLP

                     KMDSVVYDFLKCMVYNIPKKRYWLFKGPIDSGKTTLAAALLELCGGKALNVNLPLDRLN

                     FELGVAIDQFLVVFEDVKGTGGESRDLPSGQGINNLDNLRDYLDGSVKVNLEKKHLNKR

                     TQIFPPGIVTMNEYSVPKTLQARFVKQIDFRPKDYLKHCLERSEFLLEKRIIQSGIALL

                     LMLIWYRPVAEFAQSIQSRIVEWKERLDKEFSLSVYQKMKFNVAMGIGVLDWLRNSDDD

                     DEDSQENADKNEDGGEKNMEDSGHETGIDSQSQGSFQAPQSSQSVHDHNQPYHICRGFT

                     CFKKPPTPPPEPET"

     CDS             1775..1795

                     /codon_start=1

                     /product="nuclear localization signal of SV40 large T 

                     antigen"

                     /label=SV40 NLS

                     /translation="PKKKRKV"

     promoter        3612..3941

                     /label=SV40 promoter

                     /note="SV40 enhancer and early promoter"

     rep_origin      3792..3927

                     /label=SV40 ori

                     /note="SV40 origin of replication"

     CDS             3951..4550

                     /codon_start=1

                     /gene="pac from Streptomyces alboniger"

                     /product="puromycin N-acetyltransferase"

                     /label=PuroR

                     /note="confers resistance to puromycin"

                     /translation="MTEYKPTVRLATRDDVPRAVRTLAAAFADYPATRHTVDPDRHIER

                     VTELQELFLTRVGLDIGKVWVADDGAAVAVWTTPESVEAGAVFAEIGPRMAELSGSRLA

                     AQQQMEGLLAPHRPKEPAWFLATVGVSPDHQGKGLGSAVVLPGVEAAERAGVPAFLETS

                     APRNLPFYERLGFTVTADVEVPEGPRTWCMTRKPGA"

     LTR             4771..5240

                     /note="long terminal repeat from Moloney murine leukemia 

                     virus"

     rep_origin      complement(5541..6129)

                     /direction=LEFT

                     /label=ori

                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 

                     replication"

     CDS             complement(6289..7149)

                     /codon_start=1

                     /gene="bla"

                     /product="beta-lactamase"

                     /label=AmpR

                     /note="confers resistance to ampicillin, carbenicillin, and

                     related antibiotics"

                     /translation="[TEM beta-lactamase fragment, 45 aa]

                     ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVEYS

                     [TEM beta-lactamase fragment, 59 aa]

                     EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA

                     [TEM beta-lactamase fragment, 59 aa]

                     LIKHW"

     promoter        complement(7150..7254)

                     /gene="bla"

                     /label=AmpR promoter

ORIGIN

        1 ccacctgcag cctgaatatg ggccaaacag gatatctgtg gtaagcagtt cctgccccgg

       61 ctcagggcca agaacagatg gaacagctga atatgggcca aacaggatat ctgtggtaag

      121 cagttcctgc cccggctcag ggccaagaac agatggtccc cagatgcggt ccagccctca

      181 gcagtttcta gagaaccatc agatgtttcc agggtgcccc aaggacctga aatgaccctg

      241 tgccttattt gaactaacca atcagttcgc ttctcgcttc tgttcgcgcg cttctgctcc

      301 ccgagctcaa taaaagagcc cacaacccct cactcggggc gccagtcctc cgattgactg

      361 agtcgcccgg gtacccgtgt atccaataaa ccctcttgca gttgcatccg acttgtggtc

      421 tcgctgttcc ttgggagggt ctcctctgag tgattgacta cccgtcagcg ggggtctttc

      481 atttgggggc tcgtccggga tcgggagacc cctgcccagg gaccaccgac ccaccaccgg

      541 gaggcaagct ggccagcaac ttatctgtgt ctgtccgatt gtctagtgtc tatgactgat

      601 tttatgcgcc tgcgtcggta ctagttagct aactagctct gtatctggcg gacccgtggt

      661 ggaactgacg agttctgaac acccggccgc aaccctggga gacgtcccag ggactttggg

      721 ggccgttttt gtggcccgac ctgaggaagg gagtcgatgt ggaatccgac cccgtcagga

      781 tatgtggttc tggtaggaga cgagaaccta aaacagttcc cgcctccgtc tgaatttttg

      841 ctttcggttt ggaaccgaag ccgcgcgtct tgtctgctgc agcgctgcag catcgttctg

      901 tgttgtctct gtctgactgt gtttctgtat ttgtctgaaa attagggcca gactgttacc

      961 actcccttaa gtttgacctt aggtcactgg aaagatgtcg agcggatcgc tcacaaccag

     1021 tcggtagatg tcaagaagag acgttgggtt accttctgct ctgcagaatg gccaaccttt

     1081 aacgtcggat ggccgcgaga cggcaccttt aaccgagacc tcatcaccca ggttaagatc

     1141 aaggtctttt cacctggccc gcatggacac ccagaccagg tcccctacat cgtgacctgg

     1201 gaagccttgg cttttgaccc ccctccctgg gtcaagccct ttgtacaccc taagcctccg

     1261 cctcctcttc ctccatccgc cccgtctctc ccccttgaac ctcctcgttc gaccccgcct

     1321 cgatcctccc tttatccagc cctcactcct tctctaggcg ccggccggat cccgcgaccg

     1381 gtcgaccagc tttgcaaaga tggataaagt tttaaacaga gaggaatctt tgcagctaat

     1441 ggaccttcta ggtcttgaaa ggagtgcctg ggggaatatt cctctgatga gaaaggcata

     1501 tttaaaaaaa tgcaaggagt ttcatcctga taaaggagga gatgaagaaa aaatgaagaa

     1561 aatgaatact ctgtacaaga aaatggaaga tggagtaaaa tatgctcatc aacctgactt

     1621 tggaggcttc tgggatgcaa ctgagattcc aacctatgga actgatgaat gggagcagtg

     1681 gtggaatgcc tttaatgagg aaaacctgtt ttgctcagaa gaaatgccat ctagtgatga

     1741 tgaggctact gctgactctc aacattctac tcctccaaaa aagaagagaa aggtagaaga

     1801 ccccaaggac tttccttcag aattgctaag ttttttgagt catgctgtgt ttagtaatag

     1861 aactcttgct tgctttgcta tttacaccac aaaggaaaaa gctgcactgc tatacaagaa

     1921 aattatggaa aaatattctg taacctttat aagtaggcat aacagttata atcataacat

     1981 actgtttttt cttactccac acaggcatag agtgtctgct attaataact atgctcaaaa

     2041 attgtgtacc tttagctttt taatttgtaa aggggttaat aaggaatatt tgatgtatag

     2101 tgccttgact agagatccat tttctgttat tgaggaaagt ttgccaggtg ggttaaagga

     2161 gcatgatttt aatccagaag aagcagagga aactaaacaa gtgtcctgga agcttgtaac

     2221 agagtatgca atggaaacaa aatgtgatga tgtgttgtta ttgcttggga tgtacttgga

     2281 atttcagtac agttttgaaa tgtgtttaaa atgtattaaa aaagaacagc ccagccacta

     2341 taagtaccat gaaaagcatt atgcaaatgc tgctatattt gctgacagca aaaaccaaaa

     2401 aaccatatgc caacaggctg ttgatactgt tttagctaaa aagcgggttg atagcctaca

     2461 attaactaga gaacaaatgt taacaaacag atttaatgat cttttggata ggatggatat

     2521 aatgtttggt tctacaggct ctgctgacat agaagaatgg atggctggag ttgcttggct

     2581 acactgtttg ttgcccaaaa tggattcagt ggtgtatgac tttttaaaat gcatggtgta

     2641 caacattcct aaaaaaagat actggctgtt taaaggacca attgatagtg gtaaaactac

     2701 attagcagct gctttgcttg aattatgtgg ggggaaagct ttaaatgtta atttgccctt

     2761 ggacaggctg aactttgagc taggagtagc tattgaccag tttttagtag tttttgagga

     2821 tgtaaagggc actggagggg agtccagaga tttgccttca ggtcagggaa ttaataacct

     2881 ggacaattta agggattatt tggatggcag tgttaaggta aacttagaaa agaaacacct

     2941 aaataaaaga actcaaatat ttccccctgg aatagtcacc atgaatgagt acagtgtgcc

     3001 taaaacactg caggccagat ttgtaaaaca aatagatttt aggcccaaag attatttaaa

     3061 gcattgcctg gaacgcagtg agtttttgtt agaaaagaga ataattcaaa gtggcattgc

     3121 tttgcttctt atgttaattt ggtacagacc tgtggctgag tttgctcaaa gtattcagag

     3181 cagaattgtg gagtggaaag agagattgga caaagagttt agtttgtcag tgtatcaaaa

     3241 aatgaagttt aatgtggcta tgggaattgg agttttagat tggctaagaa acagtgatga

     3301 tgatgatgaa gacagccagg aaaatgctga taaaaatgaa gatggtgggg agaagaacat

     3361 ggaagactca gggcatgaaa caggcattga ttcacagtcc caaggctcat ttcaggcccc

     3421 tcagtcctca cagtctgttc atgatcataa tcagccatac cacatttgta gaggttttac

     3481 ttgctttaaa aaacctccca cacctccccc tgaacctgaa acataaaatg aatgcaattg

     3541 ttgttgttaa cggggatccc agtgtggtgg tacgtaggaa ttcgccagca cagtggtcga

     3601 ccctgtggaa tgtgtgtcag ttagggtgtg gaaagtcccc aggctcccca gcaggcagaa

     3661 gtatgcaaag catgcatctc aattagtcag caaccaggtg tggaaagtcc ccaggctccc

     3721 cagcaggcag aagtatgcaa agcatgcatc tcaattagtc agcaaccata gtcccgcccc

     3781 taactccgcc catcccgccc ctaactccgc ccagttccgc ccattctccg ccccatggct

     3841 gactaatttt ttttatttat gcagaggccg aggccgcctc ggcctctgag ctattccaga

     3901 agtagtgagg aggctttttt ggaggcctag gcttttgcaa aaagcttacc atgaccgagt

     3961 acaagcccac ggtgcgcctc gccacccgcg acgacgtccc cagggccgta cgcaccctcg

     4021 ccgccgcgtt cgccgactac cccgccacgc gccacaccgt cgatccggac cgccacatcg

     4081 agcgggtcac cgagctgcaa gaactcttcc tcacgcgcgt cgggctcgac atcggcaagg

     4141 tgtgggtcgc ggacgacggc gccgcggtgg cggtctggac cacgccggag agcgtcgaag

     4201 cgggggcggt gttcgccgag atcggcccgc gcatggccga gttgagcggt tcccggctgg

     4261 ccgcgcagca acagatggaa ggcctcctgg cgccgcaccg gcccaaggag cccgcgtggt

     4321 tcctggccac cgtcggcgtc tcgcccgacc accagggcaa gggtctgggc agcgccgtcg

     4381 tgctccccgg agtggaggcg gccgagcgcg ccggggtgcc cgccttcctg gagacctccg

     4441 cgccccgcaa cctccccttc tacgagcggc tcggcttcac cgtcaccgcc gacgtcgagg

     4501 tgcccgaagg accgcgcacc tggtgcatga cccgcaagcc cggtgcctga cgcccgcccc

     4561 acgacccgca gcgcccgacc gaaaggagcg cacgacccca tgcatcgata aaataaaaga

     4621 ttttatttag tctccagaaa aaggggggaa tgaaagaccc cacctgtagg tttggcaagc

     4681 tagcttaagt aacgccattt tgcaaggcat ggaaaaatac ataactgaga atagagaagt

     4741 tcagatcaag gtcaggaaca gatggaacag ctgaatatgg gccaaacagg atatctgtgg

     4801 taagcagttc ctgccccggc tcagggccaa gaacagatgg aacagctgaa tatgggccaa

     4861 acaggatatc tgtggtaagc agttcctgcc ccggctcagg gccaagaaca gatggtcccc

     4921 agatgcggtc cagccctcag cagtttctag agaaccatca gatgtttcca gggtgcccca

     4981 aggacctgaa atgaccctgt gccttatttg aactaaccaa tcagttcgct tctcgcttct

     5041 gttcgcgcgc ttctgctccc cgagctcaat aaaagagccc acaacccctc actcggggcg

     5101 ccagtcctcc gattgactga gtcgcccggg tacccgtgta tccaataaac cctcttgcag

     5161 ttgcatccga cttgtggtct cgctgttcct tgggagggtc tcctctgagt gattgactac

     5221 ccgtcagcgg gggtctttca catgcagcat gtatcaaaat taatttggtt ttttttctta

     5281 agtatttaca ttaaatggcc atagttgcat taatgaatcg gccaacgcgc ggggagaggc

     5341 ggtttgcgta ttgggcgctc ttccgcttcc tcgctcactg actcgctgcg ctcggtcgtt

     5401 cggctgcggc gagcggtatc agctcactca aaggcggtaa tacggttatc cacagaatca

     5461 ggggataacg caggaaagaa catgtgagca aaaggccagc aaaaggccag gaaccgtaaa

     5521 aaggccgcgt tgctggcgtt tttccatagg ctccgccccc ctgacgagca tcacaaaaat

     5581 cgacgctcaa gtcagaggtg gcgaaacccg acaggactat aaagatacca ggcgtttccc

     5641 cctggaagct ccctcgtgcg ctctcctgtt ccgaccctgc cgcttaccgg atacctgtcc

     5701 gcctttctcc cttcgggaag cgtggcgctt tctcatagct cacgctgtag gtatctcagt

     5761 tcggtgtagg tcgttcgctc caagctgggc tgtgtgcacg aaccccccgt tcagcccgac

     5821 cgctgcgcct tatccggtaa ctatcgtctt gagtccaacc cggtaagaca cgacttatcg

     5881 ccactggcag cagccactgg taacaggatt agcagagcga ggtatgtagg cggtgctaca

     5941 gagttcttga agtggtggcc taactacggc tacactagaa gaacagtatt tggtatctgc

     6001 gctctgctga agccagttac cttcggaaaa agagttggta gctcttgatc cggcaaacaa

     6061 accaccgctg gtagcggtgg tttttttgtt tgcaagcagc agattacgcg cagaaaaaaa

     6121 ggatctcaag aagatccttt gatcttttct acggggtctg acgctcagtg gaacgaaaac

     6181 tcacgttaag ggattttggt catgagatta tcaaaaagga tcttcaccta gatccttttg

     6241 cggccgcaaa tcaatctaaa gtatatatga gtaaacttgg tctgacagtt accaatgctt

     6301 aatcagtgag gcacctatct cagcgatctg tctatttcgt tcatccatag ttgcctgact

     6361 ccccgtcgtg tagataacta cgatacggga gggcttacca tctggcccca gtgctgcaat

     6421 gataccgcga gacccacgct caccggctcc agatttatca gcaataaacc agccagccgg

     6481 aagggccgag cgcagaagtg gtcctgcaac tttatccgcc tccatccagt ctattaattg

     6541 ttgccgggaa gctagagtaa gtagttcgcc agttaatagt ttgcgcaacg ttgttgccat

     6601 tgctacaggc atcgtggtgt cacgctcgtc gtttggtatg gcttcattca gctccggttc

     6661 ccaacgatca aggcgagtta catgatcccc catgttgtgc aaaaaagcgg ttagctcctt

     6721 cggtcctccg atcgttgtca gaagtaagtt ggccgcagtg ttatcactca tggttatggc

     6781 agcactgcat aattctctta ctgtcatgcc atccgtaaga tgcttttctg tgactggtga

     6841 gtactcaacc aagtcattct gagaatagtg tatgcggcga ccgagttgct cttgcccggc

     6901 gtcaatacgg gataataccg cgccacatag cagaacttta aaagtgctca tcattggaaa

     6961 acgttcttcg gggcgaaaac tctcaaggat cttaccgctg ttgagatcca gttcgatgta

     7021 acccactcgt gcacccaact gatcttcagc atcttttact ttcaccagcg tttctgggtg

     7081 agcaaaaaca ggaaggcaaa atgccgcaaa aaagggaata agggcgacac ggaaatgttg

     7141 aatactcata ctcttccttt ttcaatatta ttgaagcatt tatcagggtt attgtctcat

     7201 gagcggatac atatttgaat gtatttagaa aaataaacaa ataggggttc cgcgcacatt

     7261 tccccgaaaa gtg

//

 

No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart