pBacpAK9

$228.00

  • Model: PVT11322
  • 50 Units in Stock
Ask a question


Add to Cart:

pBacpAK9


Catalog No. PVT11322
Packing 2ug
Function /
Resistance Amp
Screen /
Strain DH5alpha
Culture temperature 37degrees centigrade
 

 

pBacpAK9 Description

Available separately or as part of the BacPAK Baculovirus Expression System (Cat. No. 631402). pBacPAK9 is a transfer vector designed for high-level expression of a cloned gene driven by the strong AcMNPV polyhedrin promoter. Flanking AcMNPV sequences allow recombination with viral DNA to transfer the expression cassette to the polyhedrin locus of the viral DNA. The polyhedrin coding sequences have been replaced by a multiple cloning site with 18 unique sites which facilitate the insertion of foreign genes in the correct orientation for expression. The Pac I site at the end of the MCS region provides translational stop codons in all three reading frames for expression of truncated proteins. pBacPAK9 has a pUC origin of replication, an M13 origin for single-stranded DNA production, and an ampicillin resistance gene for selection in E. coli.

 

pBacpAK9 Multiple cloning site

pBacpAK9-vector

 

 

pBacpAK9 Sequence

LOCUS       Exported                5538 bp ds-DNA     circular SYN 21-JAN-2018

DEFINITION  synthetic circular DNA

FEATURES             Location/Qualifiers

     source          1..5538

                     /organism="synthetic DNA construct"

                     /mol_type="other DNA"

     misc_recomb     327..1154

                     /label=baculovirus recombination region (lef2/ORF603)

                     /note="contains ORF603 and part of lef2"

     CDS             327..451

                     /codon_start=3

                     /product="baculovirus late expression factor 2"

                     /label=lef2

                     /translation="HLLIKSQDVYKPPNCQKMKTVDKLCPFAGNCKGLNPICNY"

     promoter        1158..1249

                     /gene="polh from Autographa californica"

                     /label=polyhedrin promoter

                     /note="promoter for the baculovirus polyhedrin gene"

     misc_recomb     1337..2694

                     /label=baculovirus recombination region (ORF1629)

                     /note="contains part of ORF1629"

     rep_origin      2841..3296

                     /direction=RIGHT

                     /label=f1 ori

                     /note="f1 bacteriophage origin of replication; arrow 

                     indicates direction of (+) strand synthesis"

     promoter        3578..3682

                     /gene="bla"

                     /label=AmpR promoter

     CDS             3683..4543

                     /codon_start=1

                     /gene="bla"

                     /product="beta-lactamase"

                     /label=AmpR

                     /note="confers resistance to ampicillin, carbenicillin, and

                     related antibiotics"

                     /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI

                     ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVEYS

                     PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW

                     EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA

                     LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS

                     LIKHW"

     rep_origin      4714..5302

                     /direction=RIGHT

                     /label=ori

                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 

                     replication"

ORIGIN

        1 aacggctccg cccactatta atgaaattaa aaattccaat tttaaaaaac gcagcaagag

       61 aaacatttgt atgaaagaat gcgtagaagg aaagaaaaat gtcgtcgaca tgctgaacaa

      121 caagattaat atgcctccgt gtataaaaaa aatattgaac gatttgaaag aaaacaatgt

      181 accgcgcggc ggtatgtaca ggaagaggtt tatactaaac tgttacattg caaacgtggt

      241 ttcgtgtgcc aagtgtgaaa accgatgttt aatcaaggct ctgacgcatt tctacaacca

      301 cgactccaag tgtgtgggtg aagtcatgca tcttttaatc aaatcccaag atgtgtataa

      361 accaccaaac tgccaaaaaa tgaaaactgt cgacaagctc tgtccgtttg ctggcaactg

      421 caagggtctc aatcctattt gtaattattg aataataaaa caattataaa tgctaaattt

      481 gttttttatt aacgatacaa accaaacgca acaagaacat ttgtagtatt atctataatt

      541 gaaaacgcgt agttataatc gctgaggtaa tatttaaaat cattttcaaa tgattcacag

      601 ttaatttgcg acaatataat tttattttca cataaactag acgccttgtc gtcttcttct

      661 tcgtattcct tctctttttc atttttctcc tcataaaaat taacatagtt attatcgtat

      721 ccatatatgt atctatcgta tagagtaaat tttttgttgt cataaatata tatgtctttt

      781 ttaatggggt gtatagtacc gctgcgcata gtttttctgt aatttacaac agtgctattt

      841 tctggtagtt cttcggagtg tgttgcttta attattaaat ttatataatc aatgaatttg

      901 ggatcgtcgg ttttgtacaa tatgttgccg gcatagtacg cagcttcttc tagttcaatt

      961 acaccatttt ttagcagcac cggattaaca taactttcca aaatgttgta cgaaccgtta

     1021 aacaaaaaca gttcacctcc cttttctata ctattgtctg cgagcagttg tttgttgtta

     1081 aaaataacag ccattgtaat gagacgcaca aactaatatc acaaactgga aatgtctatc

     1141 aatatatagt tgctgatatc atggagataa ttaaaatgat aaccatctcg caaataaata

     1201 agtattttac tgttttcgta acagttttgt aataaaaaaa cctataaata cggatcccgg

     1261 gaattcgagc tcggtaccag atcttctaga ttcgaactcg aggcctgcag ggcggccgct

     1321 taattaattg atccgggtta ttagtacatt tattaagcgc tagattctgt gcgttgttga

     1381 tttacagaca attgttgtac gtattttaat aattcattaa atttataatc tttagggtgg

     1441 tatgttagag cgaaaatcaa atgattttca gcgtctttat atctgaattt aaatattaaa

     1501 tcctcaatag atttgtaaaa taggtttcga ttagtttcaa acaagggttg tttttccgaa

     1561 ccgatggctg gactatctaa tggattttcg ctcaacgcca caaaacttgc caaatcttgt

     1621 agcagcaatc tagctttgtc gatattcgtt tgtgttttgt tttgtaataa aggttcgacg

     1681 tcgttcaaaa tattatgcgc ttttgtattt ctttcatcac tgtcgttagt gtacaattga

     1741 ctcgacgtaa acacgttaaa taaagcttgg acatatttaa catcgggcgt gttagcttta

     1801 ttaggccgat tatcgtcgtc gtcccaaccc tcgtcgttag aagttgcttc cgaagacgat

     1861 tttgccatag ccacacgacg cctattaatt gtgtcggcta acacgtccgc gatcaaattt

     1921 gtagttgagc tttttggaat tatttctgat tgcgggcgtt tttgggcggg tttcaatcta

     1981 actgtgcccg attttaattc agacaacacg ttagaaagcg atggtgcagg cggtggtaac

     2041 atttcagacg gcaaatctac taatggcggc ggtggtggag ctgatgataa atctaccatc

     2101 ggtggaggcg caggcggggc tggcggcgga ggcggaggcg gaggtggtgg cggtgatgca

     2161 gacggcggtt taggctcaaa tgtctcttta ggcaacacag tcggcacctc aactattgta

     2221 ctggtttcgg gcgccgtttt tggtttgacc ggtctgagac gagtgcgatt tttttcgttt

     2281 ctaatagctt ccaacaattg ttgtctgtcg tctaaaggtg cagcgggttg aggttccgtc

     2341 ggcattggtg gagcgggcgg caattcagac atcgatggtg gtggtggtgg tggaggcgct

     2401 ggaatgttag gcacgggaga aggtggtggc ggcggtgccg ccggtataat ttgttctggt

     2461 ttagtttgtt cgcgcacgat tgtgggcacc ggcgcaggcg ccgctggctg cacaacggaa

     2521 ggtcgtctgc ttcgaggcag cgcttggggt ggtggcaatt caatattata attggaatac

     2581 aaatcgtaaa aatctgctat aagcattgta atttcgctat cgtttaccgt gccgatattt

     2641 aacaaccgct caatgtaagc aattgtattg taaagagatt gtctcaagct cggatcgatc

     2701 ccgcacgccg ataacaagcc ttttcatttt tactacagca ttgtagtggc gagacacttc

     2761 gctgtcgtcg cctgatgcgg tattttctcc ttacgcatct gtgcggtatt tcacaccgca

     2821 tacgtcaaag caaccatagt acgcgccctg tagcggcgca ttaagcgcgg cgggtgtggt

     2881 ggttacgcgc agcgtgaccg ctacacttgc cagcgcccta gcgcccgctc ctttcgcttt

     2941 cttcccttcc tttctcgcca cgttcgccgg ctttccccgt caagctctaa atcgggggct

     3001 ccctttaggg ttccgattta gtgctttacg gcacctcgac cccaaaaaac ttgatttggg

     3061 tgatggttca cgtagtgggc catcgccctg atagacggtt tttcgccctt tgacgttgga

     3121 gtccacgttc tttaatagtg gactcttgtt ccaaactgga acaacactca accctatctc

     3181 gggctattct tttgatttat aagggatttt gccgatttcg gcctattggt taaaaaatga

     3241 gctgatttaa caaaaattta acgcgaattt taacaaaata ttaacgttta caattttatg

     3301 gtgcactctc agtacaatct gctctgatgc cgcatagtta agccagcccc gacacccgcc

     3361 aacacccgct gacgcgccct gacgggcttg tctgctcccg gcatccgctt acagacaagc

     3421 tgtgaccgtc tccgggagct gcatgtgtca gaggttttca ccgtcatcac cgaaacgcgc

     3481 gagacgaaag ggcctcgtga tacgcctatt tttataggtt aatgtcatga taataatggt

     3541 ttcttagacg tcaggtggca cttttcgggg aaatgtgcgc ggaaccccta tttgtttatt

     3601 tttctaaata cattcaaata tgtatccgct catgagacaa taaccctgat aaatgcttca

     3661 ataatattga aaaaggaaga gtatgagtat tcaacatttc cgtgtcgccc ttattccctt

     3721 ttttgcggca ttttgccttc ctgtttttgc tcacccagaa acgctggtga aagtaaaaga

     3781 tgctgaagat cagttgggtg cacgagtggg ttacatcgaa ctggatctca acagcggtaa

     3841 gatccttgag agttttcgcc ccgaagaacg ttttccaatg atgagcactt ttaaagttct

     3901 gctatgtggc gcggtattat cccgtattga cgccgggcaa gagcaactcg gtcgccgcat

     3961 acactattct cagaatgact tggttgagta ctcaccagtc acagaaaagc atcttacgga

     4021 tggcatgaca gtaagagaat tatgcagtgc tgccataacc atgagtgata acactgcggc

     4081 caacttactt ctgacaacga tcggaggacc gaaggagcta accgcttttt tgcacaacat

     4141 gggggatcat gtaactcgcc ttgatcgttg ggaaccggag ctgaatgaag ccataccaaa

     4201 cgacgagcgt gacaccacga tgcctgtagc aatggcaaca acgttgcgca aactattaac

     4261 tggcgaacta cttactctag cttcccggca acaattaata gactggatgg aggcggataa

     4321 agttgcagga ccacttctgc gctcggccct tccggctggc tggtttattg ctgataaatc

     4381 tggagccggt gagcgtgggt ctcgcggtat cattgcagca ctggggccag atggtaagcc

     4441 ctcccgtatc gtagttatct acacgacggg gagtcaggca actatggatg aacgaaatag

     4501 acagatcgct gagataggtg cctcactgat taagcattgg taactgtcag accaagttta

     4561 ctcatatata ctttagattg atttaaaact tcatttttaa tttaaaagga tctaggtgaa

     4621 gatccttttt gataatctca tgaccaaaat cccttaacgt gagttttcgt tccactgagc

     4681 gtcagacccc gtagaaaaga tcaaaggatc ttcttgagat cctttttttc tgcgcgtaat

     4741 ctgctgcttg caaacaaaaa aaccaccgct accagcggtg gtttgtttgc cggatcaaga

     4801 gctaccaact ctttttccga aggtaactgg cttcagcaga gcgcagatac caaatactgt

     4861 ccttctagtg tagccgtagt taggccacca cttcaagaac tctgtagcac cgcctacata

     4921 cctcgctctg ctaatcctgt taccagtggc tgctgccagt ggcgataagt cgtgtcttac

     4981 cgggttggac tcaagacgat agttaccgga taaggcgcag cggtcgggct gaacgggggg

     5041 ttcgtgcaca cagcccagct tggagcgaac gacctacacc gaactgagat acctacagcg

     5101 tgagctatga gaaagcgcca cgcttcccga agggagaaag gcggacaggt atccggtaag

     5161 cggcagggtc ggaacaggag agcgcacgag ggagcttcca gggggaaacg cctggtatct

     5221 ttatagtcct gtcgggtttc gccacctctg acttgagcgt cgatttttgt gatgctcgtc

     5281 aggggggcgg agcctatgga aaaacgccag caacgcggcc tttttacggt tcctggcctt

     5341 ttgctggcct tttgctcaca tgttctttcc tgcgttatcc cctgattctg tggataaccg

     5401 tattaccgcc tttgagtgag ctgataccgc tcgccgcagc cgaacgaccg agcgcagcga

     5461 gtcagtgagc gaggaagcgg aagagcgccc aatacgcaaa ccgcctctcc ccgcgcgttg

     5521 gccgattcat taatgcag

//

Caution:
Product is for research use only!

No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart