pBAD/ His/ LacZ Plasmid

$216.00

  • Model: PVT0707
  • 50 Units in Stock
Ask a question


Add to Cart:

pBAD/ His/ LacZ Plasmid

PVT0707   2ug
 

pBAD/ His/ LacZ Plasmid Information

Alias: pBAD-His-LacZ

Plasmid classification: E. coli carrier; PBAD series expression plasmids

Prokaryotic resistance Ampicillin

Clonal strain: Escherichia coli DH5 α

Culture conditions: 37℃

 

pBAD/ His/ LacZ Plasmid Sequence

LOCUS       Exported                7115 bp ds-DNA     circular SYN 05-NOV-2016

DEFINITION  synthetic circular DNA

FEATURES             Location/Qualifiers

     source          1..7115

                     /organism="synthetic DNA construct"

                     /mol_type="other DNA"

     promoter        1..285

                     /gene="araBAD"

                     /note="araBAD promoter"

                     /note="promoter of the L-arabinose operon of E. coli; the 

                     araC regulatory gene is transcribed in the opposite 

                     direction (Guzman et al., 1995)"

     CDS             332..349

                     /codon_start=1

                     /product="6xHis affinity tag"

                     /note="6xHis"

                     /translation="HHHHHH"

     CDS             353..385

                     /codon_start=1

                     /product="leader peptide from bacteriophage T7 gene 10"

                     /note="T7 tag (gene 10 leader)"

                     /note="promotes efficient translation in E. coli"

                     /translation="MASMTGGQQMG"

     CDS             389..412

                     /codon_start=1

                     /product="Xpress(TM) epitope tag, including an enterokinase

                     recognition and cleavage site"

                     /note="Xpress(TM) tag"

                     /translation="DLYDDDDK"

     CDS             431..3478

                     /codon_start=1

                     /gene="lacZ"

                     /product="beta-galactosidase"

                     /note="lacZ"

                     /translation="VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS

                     LNGEWRFAWFPVPEAVPESWLECDLPEADTVVVPSNWQMHGYDAPIYTNVTYPITVNPP

                     FVPTENPTGCYSLTFNVDESWLQEGQTRIIFDGVNSAFHLWCNGRWVGYGQDSRLPSEF

                     DLSAFLRAGENRLAVMVLRWSDGSYLEDQDMWRMSGIFRDVSLLHKPTTQISDFHVATR

                     FNDDFSRAVLEAEVQMCGELRDYLRVTVSLWQGETQVASGTAPFGGEIIDERGGYADRV

                     TLRLNVENPKLWSAEIPNLYRAVVELHTADGTLIEAEACDVGFREVRIENGLLLLNGKP

                     LLIRGVNRHEHHPLHGQVMDEQTMVQDILLMKQNNFNAVRCSHYPNHPLWYTLCDRYGL

                     YVVDEANIETHGMVPMNRLTDDPRWLPAMSERVTRMVQRDRNHPSVIIWSLGNESGHGA

                     NHDALYRWIKSVDPSRPVQYEGGGADTTATDIICPMYARVDEDQPFPAVPKWSIKKWLS

                     LPGETRPLILCEYAHAMGNSLGGFAKYWQAFRQYPRLQGGFVWDWVDQSLIKYDENGNP

                     WSAYGGDFGDTPNDRQFCMNGLVFADRTPHPALTEAKHQQQFFQFRLSGQTIEVTSEYL

                     FRHSDNELLHWMVALDGKPLASGEVPLDVAPQGKQLIELPELPQPESAGQLWLTVRVVQ

                     PNATAWSEAGHISAWQQWRLAENLSVTLPAASHAIPHLTTSEMDFCIELGNKRWQFNRQ

                     SGFLSQMWIGDKKQLLTPLRDQFTRAPLDNDIGVSEATRIDPNAWVERWKAAGHYQAEA

                     ALLQCTADTLADAVLITTAHAWQHQGKTLFISRKTYRIDGSGQMAITVDVEVASDTPHP

                     ARIGLNCQLAQVAERVNWLGLGPQENYPDRLTAACFDRWDLPLSDMYTPYVFPSENGLR

                     CGTRELNYGPHQWRGDFQFNISRYSQQQLMETSHRHLLHAEEGTWLNIDGFHMGIGGDD

                     SWSPSVSAEFQLSAGRYHYQLVWCQK"

     terminator      3685..3771

                     /gene="Escherichia coli rrnB"

                     /note="rrnB T1 terminator"

                     /note="transcription terminator T1 from the E. coli rrnB 

                     gene"

     terminator      3863..3890

                     /note="rrnB T2 terminator"

                     /note="transcription terminator T2 from the E. coli rrnB 

                     gene"

     promoter        3910..4001

                     /gene="bla"

                     /note="AmpR promoter"

     CDS             4002..4862

                     /codon_start=1

                     /gene="bla"

                     /product="beta-lactamase"

                     /note="AmpR"

                     /note="confers resistance to ampicillin, carbenicillin, and

                     related antibiotics"

                     /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI

                     ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS

                     PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW

                     EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA

                     LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS

                     LIKHW"

     rep_origin      5033..5621

                     /direction=RIGHT

                     /note="ori"

                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 

                     replication"

     misc_feature    5807..5947

                     /note="bom"

                     /note="basis of mobility region from pBR322"

     CDS             complement(6211..7089)

                     /codon_start=1

                     /gene="araC"

                     /product="L-arabinose regulatory protein"

                     /note="araC"

                     /translation="MAEAQNDPLLPGYSFNAHLVAGLTPIEANGYLDFFIDRPLGMKGY

                     ILNLTIRGQGVVKNQGREFVCRPGDILLFPPGEIHHYGRHPEAREWYHQWVYFRPRAYW

                     HEWLNWPSIFANTGFFRPDEAHQPHFSDLFGQIINAGQGEGRYSELLAINLLEQLLLRR

                     MEAINESLHPPMDNRVREACQYISDHLADSNFDIASVAQHVCLSPSRLSHLFRQQLGIS

                     VLSWREDQRISQAKLLLSTTRMPIATVGRNVGFDDQLYFSRVFKKCTGASPSEFRAGCE

                     EKVNDVAVKLS"

ORIGIN

        1 aagaaaccaa ttgtccatat tgcatcagac attgccgtca ctgcgtcttt tactggctct

       61 tctcgctaac caaaccggta accccgctta ttaaaagcat tctgtaacaa agcgggacca

      121 aagccatgac aaaaacgcgt aacaaaagtg tctataatca cggcagaaaa gtccacattg

      181 attatttgca cggcgtcaca ctttgctatg ccatagcatt tttatccata agattagcgg

      241 atcctacctg acgcttttta tcgcaactct ctactgtttc tccatacccg tttttttggg

      301 ctaacaggag gaattaacca tggggggttc tcatcatcat catcatcatg gtatggctag

      361 catgactggt ggacagcaaa tgggtcggga tctgtacgac gatgacgata aggatccaat

      421 gatagatccc gtcgttttac aacgtcgtga ctgggaaaac cctggcgtta cccaacttaa

      481 tcgccttgca gcacatcccc ctttcgccag ctggcgtaat agcgaagagg cccgcaccga

      541 tcgcccttcc caacagttgc gcagcctgaa tggcgaatgg cgctttgcct ggtttccggt

      601 accagaagcg gtgccggaaa gctggctgga gtgcgatctt cctgaggccg atactgtcgt

      661 cgtcccctca aactggcaga tgcacggtta cgatgcgccc atctacacca acgtaaccta

      721 tcccattacg gtcaatccgc cgtttgttcc cacggagaat ccgacgggtt gttactcgct

      781 cacatttaat gttgatgaaa gctggctaca ggaaggccag acgcgaatta tttttgatgg

      841 cgttaactcg gcgtttcatc tgtggtgcaa cgggcgctgg gtcggttacg gccaggacag

      901 tcgtttgccg tctgaatttg acctgagcgc atttttacgc gccggagaaa accgcctcgc

      961 ggtgatggtg ctgcgttgga gtgacggcag ttatctggaa gatcaggata tgtggcggat

     1021 gagcggcatt ttccgtgacg tctcgttgct gcataaaccg actacacaaa tcagcgattt

     1081 ccatgttgcc actcgcttta atgatgattt cagccgcgct gtactggagg ctgaagttca

     1141 gatgtgcggc gagttgcgtg actacctacg ggtaacagtt tctttatggc agggtgaaac

     1201 gcaggtcgcc agcggcaccg cgcctttcgg cggtgaaatt atcgatgagc gtggtggtta

     1261 tgccgatcgc gtcacactac gtctgaacgt cgaaaacccg aaactgtgga gcgccgaaat

     1321 cccgaatctc tatcgtgcgg tggttgaact gcacaccgcc gacggcacgc tgattgaagc

     1381 agaagcctgc gatgtcggtt tccgcgaggt gcggattgaa aatggtctgc tgctgctgaa

     1441 cggcaagccg ttgctgattc gaggcgttaa ccgtcacgag catcatcctc tgcatggtca

     1501 ggtcatggat gagcagacga tggtgcagga tatcctgctg atgaagcaga acaactttaa

     1561 cgccgtgcgc tgttcgcatt atccgaacca tccgctgtgg tacacgctgt gcgaccgcta

     1621 cggcctgtat gtggtggatg aagccaatat tgaaacccac ggcatggtgc caatgaatcg

     1681 tctgaccgat gatccgcgct ggctaccggc gatgagcgaa cgcgtaacgc gaatggtgca

     1741 gcgcgatcgt aatcacccga gtgtgatcat ctggtcgctg gggaatgaat caggccacgg

     1801 cgctaatcac gacgcgctgt atcgctggat caaatctgtc gatccttccc gcccggtgca

     1861 gtatgaaggc ggcggagccg acaccacggc caccgatatt atttgcccga tgtacgcgcg

     1921 cgtggatgaa gaccagccct tcccggctgt gccgaaatgg tccatcaaaa aatggctttc

     1981 gctacctgga gagacgcgcc cgctgatcct ttgcgaatac gcccacgcga tgggtaacag

     2041 tcttggcggt ttcgctaaat actggcaggc gtttcgtcag tatccccgtt tacagggcgg

     2101 cttcgtctgg gactgggtgg atcagtcgct gattaaatat gatgaaaacg gcaacccgtg

     2161 gtcggcttac ggcggtgatt ttggcgatac gccgaacgat cgccagttct gtatgaacgg

     2221 tctggtcttt gccgaccgca cgccgcatcc agcgctgacg gaagcaaaac accagcagca

     2281 gtttttccag ttccgtttat ccgggcaaac catcgaagtg accagcgaat acctgttccg

     2341 tcatagcgat aacgagctcc tgcactggat ggtggcgctg gatggtaagc cgctggcaag

     2401 cggtgaagtg cctctggatg tcgctccaca aggtaaacag ttgattgaac tgcctgaact

     2461 accgcagccg gagagcgccg ggcaactctg gctcacagta cgcgtagtgc aaccgaacgc

     2521 gaccgcatgg tcagaagccg ggcacatcag cgcctggcag cagtggcgtc tggcggaaaa

     2581 cctcagtgtg acgctccccg ccgcgtccca cgccatcccg catctgacca ccagcgaaat

     2641 ggatttttgc atcgagctgg gtaataagcg ttggcaattt aaccgccagt caggctttct

     2701 ttcacagatg tggattggcg ataaaaaaca actgctgacg ccgctgcgcg atcagttcac

     2761 ccgtgcaccg ctggataacg acattggcgt aagtgaagcg acccgcattg accctaacgc

     2821 ctgggtcgaa cgctggaagg cggcgggcca ttaccaggcc gaagcagcgt tgttgcagtg

     2881 cacggcagat acacttgctg atgcggtgct gattacgacc gctcacgcgt ggcagcatca

     2941 ggggaaaacc ttatttatca gccggaaaac ctaccggatt gatggtagtg gtcaaatggc

     3001 gattaccgtt gatgttgaag tggcgagcga tacaccgcat ccggcgcgga ttggcctgaa

     3061 ctgccagctg gcgcaggtag cagagcgggt aaactggctc ggattagggc cgcaagaaaa

     3121 ctatcccgac cgccttactg ccgcctgttt tgaccgctgg gatctgccat tgtcagacat

     3181 gtataccccg tacgtcttcc cgagcgaaaa cggtctgcgc tgcgggacgc gcgaattgaa

     3241 ttatggccca caccagtggc gcggcgactt ccagttcaac atcagccgct acagtcaaca

     3301 gcaactgatg gaaaccagcc atcgccatct gctgcacgcg gaagaaggca catggctgaa

     3361 tatcgacggt ttccatatgg ggattggtgg cgacgactcc tggagcccgt cagtatcggc

     3421 ggaattccag ctgagcgccg gtcgctacca ttaccagttg gtctggtgtc aaaaataagc

     3481 ttggctgttt tggcggatga gagaagattt tcagcctgat acagattaaa tcagaacgca

     3541 gaagcggtct gataaaacag aatttgcctg gcggcagtag cgcggtggtc ccacctgacc

     3601 ccatgccgaa ctcagaagtg aaacgccgta gcgccgatgg tagtgtgggg tctccccatg

     3661 cgagagtagg gaactgccag gcatcaaata aaacgaaagg ctcagtcgaa agactgggcc

     3721 tttcgtttta tctgttgttt gtcggtgaac gctctcctga gtaggacaaa tccgccggga

     3781 gcggatttga acgttgcgaa gcaacggccc ggagggtggc gggcaggacg cccgccataa

     3841 actgccaggc atcaaattaa gcagaaggcc atcctgacgg atggcctttt tgcgtttcta

     3901 caaactcttt ttgtttattt ttctaaatac attcaaatat gtatccgctc atgagacaat

     3961 aaccctgata aatgcttcaa taatattgaa aaaggaagag tatgagtatt caacatttcc

     4021 gtgtcgccct tattcccttt tttgcggcat tttgccttcc tgtttttgct cacccagaaa

     4081 cgctggtgaa agtaaaagat gctgaagatc agttgggtgc acgagtgggt tacatcgaac

     4141 tggatctcaa cagcggtaag atccttgaga gttttcgccc cgaagaacgt tttccaatga

     4201 tgagcacttt taaagttctg ctatgtggcg cggtattatc ccgtgttgac gccgggcaag

     4261 agcaactcgg tcgccgcata cactattctc agaatgactt ggttgagtac tcaccagtca

     4321 cagaaaagca tcttacggat ggcatgacag taagagaatt atgcagtgct gccataacca

     4381 tgagtgataa cactgcggcc aacttacttc tgacaacgat cggaggaccg aaggagctaa

     4441 ccgctttttt gcacaacatg ggggatcatg taactcgcct tgatcgttgg gaaccggagc

     4501 tgaatgaagc cataccaaac gacgagcgtg acaccacgat gcctgtagca atggcaacaa

     4561 cgttgcgcaa actattaact ggcgaactac ttactctagc ttcccggcaa caattaatag

     4621 actggatgga ggcggataaa gttgcaggac cacttctgcg ctcggccctt ccggctggct

     4681 ggtttattgc tgataaatct ggagccggtg agcgtgggtc tcgcggtatc attgcagcac

     4741 tggggccaga tggtaagccc tcccgtatcg tagttatcta cacgacgggg agtcaggcaa

     4801 ctatggatga acgaaataga cagatcgctg agataggtgc ctcactgatt aagcattggt

     4861 aactgtcaga ccaagtttac tcatatatac tttagattga tttaaaactt catttttaat

     4921 ttaaaaggat ctaggtgaag atcctttttg ataatctcat gaccaaaatc ccttaacgtg

     4981 agttttcgtt ccactgagcg tcagaccccg tagaaaagat caaaggatct tcttgagatc

     5041 ctttttttct gcgcgtaatc tgctgcttgc aaacaaaaaa accaccgcta ccagcggtgg

     5101 tttgtttgcc ggatcaagag ctaccaactc tttttccgaa ggtaactggc ttcagcagag

     5161 cgcagatacc aaatactgtc cttctagtgt agccgtagtt aggccaccac ttcaagaact

     5221 ctgtagcacc gcctacatac ctcgctctgc taatcctgtt accagtggct gctgccagtg

     5281 gcgataagtc gtgtcttacc gggttggact caagacgata gttaccggat aaggcgcagc

     5341 ggtcgggctg aacggggggt tcgtgcacac agcccagctt ggagcgaacg acctacaccg

     5401 aactgagata cctacagcgt gagctatgag aaagcgccac gcttcccgaa gggagaaagg

     5461 cggacaggta tccggtaagc ggcagggtcg gaacaggaga gcgcacgagg gagcttccag

     5521 ggggaaacgc ctggtatctt tatagtcctg tcgggtttcg ccacctctga cttgagcgtc

     5581 gatttttgtg atgctcgtca ggggggcgga gcctatggaa aaacgccagc aacgcggcct

     5641 ttttacggtt cctggccttt tgctggcctt ttgctcacat gttctttcct gcgttatccc

     5701 ctgattctgt ggataaccgt attaccgcct ttgagtgagc tgataccgct cgccgcagcc

     5761 gaacgaccga gcgcagcgag tcagtgagcg aggaagcgga agagcgcctg atgcggtatt

     5821 ttctccttac gcatctgtgc ggtatttcac accgcatatg gtgcactctc agtacaatct

     5881 gctctgatgc cgcatagtta agccagtata cactccgcta tcgctacgtg actgggtcat

     5941 ggctgcgccc cgacacccgc caacacccgc tgacgcgccc tgacgggctt gtctgctccc

     6001 ggcatccgct tacagacaag ctgtgaccgt ctccgggagc tgcatgtgtc agaggttttc

     6061 accgtcatca ccgaaacgcg cgaggcagca gatcaattcg cgcgcgaagg cgaagcggca

     6121 tgcataatgt gcctgtcaaa tggacgaagc agggattctg caaaccctat gctactccgt

     6181 caagccgtca attgtctgat tcgttaccaa ttatgacaac ttgacggcta catcattcac

     6241 tttttcttca caaccggcac ggaactcgct cgggctggcc ccggtgcatt ttttaaatac

     6301 ccgcgagaaa tagagttgat cgtcaaaacc aacattgcga ccgacggtgg cgataggcat

     6361 ccgggtggtg ctcaaaagca gcttcgcctg gctgatacgt tggtcctcgc gccagcttaa

     6421 gacgctaatc cctaactgct ggcggaaaag atgtgacaga cgcgacggcg acaagcaaac

     6481 atgctgtgcg acgctggcga tatcaaaatt gctgtctgcc aggtgatcgc tgatgtactg

     6541 acaagcctcg cgtacccgat tatccatcgg tggatggagc gactcgttaa tcgcttccat

     6601 gcgccgcagt aacaattgct caagcagatt tatcgccagc agctccgaat agcgcccttc

     6661 cccttgcccg gcgttaatga tttgcccaaa caggtcgctg aaatgcggct ggtgcgcttc

     6721 atccgggcga aagaaccccg tattggcaaa tattgacggc cagttaagcc attcatgcca

     6781 gtaggcgcgc ggacgaaagt aaacccactg gtgataccat tcgcgagcct ccggatgacg

     6841 accgtagtga tgaatctctc ctggcgggaa cagcaaaata tcacccggtc ggcaaacaaa

     6901 ttctcgtccc tgatttttca ccaccccctg accgcgaatg gtgagattga gaatataacc

     6961 tttcattccc agcggtcggt cgataaaaaa atcgagataa ccgttggcct caatcggcgt

     7021 taaacccgcc accagatggg cattaaacga gtatcccggc agcaggggat cattttgcgc

     7081 ttcagccata cttttcatac tcccgccatt cagag

//

 

Caution:
1.  This product is FOR RESEARCH USE ONLY!
2.  The item is lyophilized form, Please take the powder plasmid by centrifugation at 5000rpm/min for 1min. Add 20μl ddH2O in to the tube of plasmid.

 

Search name

pBAD/His/LacZ,Plasmid pBAD/His/LacZ,pBAD/His/LacZ vector

No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart