pBAD-HisA
Catalog No. PVT10606
Packing 2ug
pBAD-HisA Information
Function E.coli expression plasmid
Promoter: araBAD promoter
Replicon: pBR322 ori
Terminator: rrnB T1 Terminator
Plasmid classification: large intestine plasmid; large intestine expression plasmid; pBAD series plasmid.
Plasmid size: 4102bp
Plasmid label: N-His, N-EK, N-xPress Epitope
Prokaryotic resistance: ampicillin Amp
Cloned strains of Escherichia coli, Top10 and other Escherichia coli
Culture conditions: 37 centigrade, aerobic, LB
Expression of host: LMG194 and other Escherichia coli
Culture conditions: 37 centigrade, aerobic, LB
Inducement: Arabia sugar
5'sequencing primers: PBAD30.F (AGATTAGCGGATCCTACCTG)
3'sequencing primers: PBAD30.R (CACTTCTGAGTTCGGCATGG)
pBAD-HisA Description
PBAD-HisA plasmids are derived from pBR322 vectors. The vector is designed to express and purify recombinant target protein in Escherichia coli in a dose-dependent manner. The E.coli araBAD promoter (pBAD) enhanced the soluble expression level of E.coli recombinant protein. The regulatory protein AraC on pBAD/His and pBAD/Myc His vectors can regulate pBad promoter. The pBAD/Myc-His A carrier is the Arabia sugar control carrier; in the glucose free medium, the Arabia sugar is positively regulating the expression of the target gene, and the soluble expression of the target protein is optimized by regulating the concentration level of the sugar in Arabia.

pBAD-HisA Sequence
LOCUS Exported 4102 bp ds-DNA circular SYN 14-9-2015
KEYWORDS Untitled
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 4102)
AUTHORS admin
TITLE Direct Submission
JOURNAL Exported 2015-9-14
FEATURES Location/Qualifiers
source 1..4102
/organism="synthetic DNA construct"
/mol_type="other DNA"
promoter 120..285
/gene="araBAD"
/note="araBAD promoter"
/note="promoter of the L-arabinose operon of E. coli; the
araC regulatory gene is transcribed in the opposite
direction"
CDS 331..348
/codon_start=1
/product="6xHis affinity tag"
/note="6xHis"
/translation="HHHHHH"
CDS 352..384
/codon_start=1
/product="leader peptide from bacteriophage T7 gene 10"
/note="T7 tag (gene 10 leader)"
/note="promotes efficient translation in E. coli"
/translation="MASMTGGQQMG"
CDS 388..411
/codon_start=1
/product="Xpress(TM) epitope tag, including an enterokinase
recognition and cleavage site"
/note="Xpress(TM) tag"
/translation="DLYDDDDK"
terminator 673..759
/gene="Escherichia coli rrnB"
/note="rrnB T1 terminator"
/note="transcription terminator T1 from the E. coli rrnB
gene"
terminator 851..878
/note="rrnB T2 terminator"
/note="transcription terminator T2 from the E. coli rrnB
gene"
promoter 897..988
/gene="bla"
/note="AmpR promoter"
CDS 989..1849
/codon_start=1
/gene="bla"
/product="beta-lactamase"
/note="AmpR"
/note="confers resistance to ampicillin, carbenicillin, and
related antibiotics"
/translation="[TEM beta-lactamase fragment, 45 aa]
ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS
[TEM beta-lactamase fragment, 59 aa]
EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA
[TEM beta-lactamase fragment, 59 aa]
LIKHW"
rep_origin 2020..2608
/direction=RIGHT
/note="ori"
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
misc_feature 2794..2934
/note="bom"
/note="basis of mobility region from pBR322"
CDS complement(3198..4076)
/codon_start=1
/gene="araC"
/product="L-arabinose regulatory protein"
/note="araC"
/translation="MAEAQNDPLLPGYSFNAHLVAGLTPIEANGYLDFFIDRPLGMKGY
ILNLTIRGQGVVKNQGREFVCRPGDILLFPPGEIHHYGRHPEAREWYHQWVYFRPRAYW
HEWLNWPSIFANTGFFRPDEAHQPHFSDLFGQIINAGQGEGRYSELLAINLLEQLLLRR
MEAINESLHPPMDNRVREACQYISDHLADSNFDIASVAQHVCLSPSRLSHLFRQQLGIS
VLSWREDQRISQAKLLLSTTRMPIATVGRNVGFDDQLYFSRVFKKCTGASPSEFRAGCE
EKVNDVAVKLS"
ORIGIN
1 aagaaaccaa ttgtccatat tgcatcagac attgccgtca ctgcgtcttt tactggctct
61 tctcgctaac caaaccggta accccgctta ttaaaagcat tctgtaacaa agcgggacca
121 aagccatgac aaaaacgcgt aacaaaagtg tctataatca cggcagaaaa gtccacattg
181 attatttgca cggcgtcaca ctttgctatg ccatagcatt tttatccata agattagcgg
241 atcctacctg acgcttttta tcgcaactct ctactgtttc tccatacccg ttttttgggc
301 taacaggagg aattaaccat ggggggttct catcatcatc atcatcatgg tatggctagc
361 atgactggtg gacagcaaat gggtcgggat ctgtacgacg atgacgataa ggatcgatgg
421 ggatccgagc tcgagatctg cagctggtac catatgggaa ttcgaagctt ggctgttttg
481 gcggatgaga gaagattttc agcctgatac agattaaatc agaacgcaga agcggtctga
541 taaaacagaa tttgcctggc ggcagtagcg cggtggtccc acctgacccc atgccgaact
601 cagaagtgaa acgccgtagc gccgatggta gtgtggggtc tccccatgcg agagtaggga
661 actgccaggc atcaaataaa acgaaaggct cagtcgaaag actgggcctt tcgttttatc
721 tgttgtttgt cggtgaacgc tctcctgagt aggacaaatc cgccgggagc ggatttgaac
781 gttgcgaagc aacggcccgg agggtggcgg gcaggacgcc cgccataaac tgccaggcat
841 caaattaagc agaaggccat cctgacggat ggcctttttg cgtttctaca aactcttttg
901 tttatttttc taaatacatt caaatatgta tccgctcatg agacaataac cctgataaat
961 gcttcaataa tattgaaaaa ggaagagtat gagtattcaa catttccgtg tcgcccttat
1021 tccctttttt gcggcatttt gccttcctgt ttttgctcac ccagaaacgc tggtgaaagt
1081 aaaagatgct gaagatcagt tgggtgcacg agtgggttac atcgaactgg atctcaacag
1141 cggtaagatc cttgagagtt ttcgccccga agaacgtttt ccaatgatga gcacttttaa
1201 agttctgcta tgtggcgcgg tattatcccg tgttgacgcc gggcaagagc aactcggtcg
1261 ccgcatacac tattctcaga atgacttggt tgagtactca ccagtcacag aaaagcatct
1321 tacggatggc atgacagtaa gagaattatg cagtgctgcc ataaccatga gtgataacac
No customer comments for the moment.