pBAD/ Myc- HisA Plasmid

$216.00

  • Model: PVT0701
  • 49 Units in Stock
Ask a question


Add to Cart:

pBAD/ Myc-HisA Plasmid

PVT0701   2ug

 

pBAD/Myc-HisA Plasmid Description

Pbad/his and Pbad/myc-his carrier is derived from pBR322 carrier. The carrier is designed to regulate, dose-dependent expression and purify recombinant protein in Escherichia coli. The level of soluble expression of recombinant Escherichia coli protein was enhanced with E. coli Arabad promoter (PBAD). The regulatory protein Arac on the pbad/his and pbad/myc his vectors can regulate the PBAD promoter.

 

pBAD/Myc-HisA Plasmid Multiple cloning site

pBAD-Myc-HisA-vector

 

pBAD/Myc-HisA Plasmid Sequence

LOCUS       Exported                4094 bp ds-DNA     circular SYN 11-SEP-2016
DEFINITION  synthetic circular DNA
KEYWORDS    pBAD Myc-HisA
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 4094)
  TITLE     Direct Submission
FEATURES             Location/Qualifiers
     source          1..4094
                     /organism="synthetic DNA construct"
                     /mol_type="other DNA"
     promoter        1..285
                     /gene="araBAD"
                     /note="araBAD promoter"
                     /note="promoter of the L-arabinose operon of E. coli; the
                     araC regulatory gene is transcribed in the opposite
                     direction (Guzman et al., 1995)"
     CDS             377..406
                     /codon_start=1
                     /product="Myc (human c-Myc oncogene) epitope tag"
                     /note="Myc"
                     /translation="EQKLISEEDL"
     CDS             422..439
                     /codon_start=1
                     /product="6xHis affinity tag"
                     /note="6xHis"
                     /translation="HHHHHH"
     terminator      665..751
                     /gene="Escherichia coli rrnB"
                     /note="rrnB T1 terminator"
                     /note="transcription terminator T1 from the E. coli rrnB
                     gene"
     terminator      843..870
                     /note="rrnB T2 terminator"
                     /note="transcription terminator T2 from the E. coli rrnB
                     gene"
     promoter        889..980
                     /gene="bla"
                     /note="AmpR promoter"
     CDS             981..1841
                     /codon_start=1
                     /gene="bla"
                     /product="beta-lactamase"
                     /note="AmpR"
                     /note="confers resistance to ampicillin, carbenicillin, and
                     related antibiotics"
                     /translation="[TEM beta-lactamase fragment, 45 aa]
                     ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS
                     PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW
                     EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA
                     LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS
                     LIKHW"
     rep_origin      2012..2600
                     /direction=RIGHT
                     /note="ori"
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
                     replication"
     misc_feature    2786..2926
                     /note="bom"
                     /note="basis of mobility region from pBR322"
     CDS             complement(3190..4068)
                     /codon_start=1
                     /gene="araC"
                     /product="L-arabinose regulatory protein"
                     /note="araC"
                     /translation="MAEAQNDPLLPGYSFNAHLVAGLTPIEANGYLDFFIDRPLGMKGY
                     ILNLTIRGQGVVKNQGREFVCRPGDILLFPPGEIHHYGRHPEAREWYHQWVYFRPRAYW
                     HEWLNWPSIFANTGFFRPDEAHQPHFSDLFGQIINAGQGEGRYSELLAINLLEQLLLRR
                     MEAINESLHPPMDNRVREACQYISDHLADSNFDIASVAQHVCLSPSRLSHLFRQQLGIS
                     VLSWREDQRISQAKLLLSTTRMPIATVGRNVGFDDQLYFSRVFKKCTGASPSEFRAGCE
                     EKVNDVAVKLS"
ORIGIN
        1 aagaaaccaa ttgtccatat tgcatcagac attgccgtca ctgcgtcttt tactggctct
       61 tctcgctaac caaaccggta accccgctta ttaaaagcat tctgtaacaa agcgggacca
      121 aagccatgac aaaaacgcgt aacaaaagtg tctataatca cggcagaaaa gtccacattg
      181 attatttgca cggcgtcaca ctttgctatg ccatagcatt tttatccata agattagcgg
      241 atcctacctg acgcttttta tcgcaactct ctactgtttc tccatacccg ttttttgggc
      301 taacaggagg aattaaccat ggatccgagc tcgagatctg cagctggtac catatgggaa
      361 ttcgaagctt gggcccgaac aaaaactcat ctcagaagag gatctgaata gcgccgtcga
      421 ccatcatcat catcatcatt gagtttaaac ggtctccagc ttggctgttt tggcggatga
      481 gagaagattt tcagcctgat acagattaaa tcagaacgca gaagcggtct gataaaacag
      541 aatttgcctg gcggcagtag cgcggtggtc ccacctgacc ccatgccgaa ctcagaagtg
      601 aaacgccgta gcgccgatgg tagtgtgggg tctccccatg cgagagtagg gaactgccag
      661 gcatcaaata aaacgaaagg ctcagtcgaa agactgggcc tttcgtttta tctgttgttt
      721 gtcggtgaac gctctcctga gtaggacaaa tccgccggga gcggatttga acgttgcgaa
      781 gcaacggccc ggagggtggc gggcaggacg cccgccataa actgccaggc atcaaattaa
      841 gcagaaggcc atcctgacgg atggcctttt tgcgtttcta caaactcttt tgtttatttt
      901 tctaaataca ttcaaatatg tatccgctca tgagacaata accctgataa atgcttcaat
      961 aatattgaaa aaggaagagt atgagtattc aacatttccg tgtcgccctt attccctttt
     1021 ttgcggcatt ttgccttcct gtttttgctc acccagaaac gctggtgaaa gtaaaagatg
     1081 ctgaagatca gttgggtgca cgagtgggtt acatcgaact ggatctcaac agcggtaaga
     1141 tccttgagag ttttcgcccc gaagaacgtt ttccaatgat gagcactttt aaagttctgc
     1201 tatgtggcgc ggtattatcc cgtgttgacg ccgggcaaga gcaactcggt cgccgcatac
     1261 actattctca gaatgacttg gttgagtact caccagtcac agaaaagcat cttacggatg
     1321 gcatgacagt aagagaatta tgcagtgctg ccataaccat gagtgataac actgcggcca
     1381 acttacttct gacaacgatc ggaggaccga aggagctaac cgcttttttg cacaacatgg
     1441 gggatcatgt aactcgcctt gatcgttggg aaccggagct gaatgaagcc ataccaaacg
     1501 acgagcgtga caccacgatg cctgtagcaa tggcaacaac gttgcgcaaa ctattaactg
     1561 gcgaactact tactctagct tcccggcaac aattaataga ctggatggag gcggataaag
     1621 ttgcaggacc acttctgcgc tcggcccttc cggctggctg gtttattgct gataaatctg
     1681 gagccggtga gcgtgggtct cgcggtatca ttgcagcact ggggccagat ggtaagccct
     1741 cccgtatcgt agttatctac acgacgggga gtcaggcaac tatggatgaa cgaaatagac
     1801 agatcgctga gataggtgcc tcactgatta agcattggta actgtcagac caagtttact
     1861 catatatact ttagattgat ttaaaacttc atttttaatt taaaaggatc taggtgaaga
     1921 tcctttttga taatctcatg accaaaatcc cttaacgtga gttttcgttc cactgagcgt
     1981 cagaccccgt agaaaagatc aaaggatctt cttgagatcc tttttttctg cgcgtaatct
     2041 gctgcttgca aacaaaaaaa ccaccgctac cagcggtggt ttgtttgccg gatcaagagc
     2101 taccaactct ttttccgaag gtaactggct tcagcagagc gcagatacca aatactgtcc
     2161 ttctagtgta gccgtagtta ggccaccact tcaagaactc tgtagcaccg cctacatacc
     2221 tcgctctgct aatcctgtta ccagtggctg ctgccagtgg cgataagtcg tgtcttaccg
     2281 ggttggactc aagacgatag ttaccggata aggcgcagcg gtcgggctga acggggggtt
     2341 cgtgcacaca gcccagcttg gagcgaacga cctacaccga actgagatac ctacagcgtg
     2401 agctatgaga aagcgccacg cttcccgaag ggagaaaggc ggacaggtat ccggtaagcg
     2461 gcagggtcgg aacaggagag cgcacgaggg agcttccagg gggaaacgcc tggtatcttt
     2521 atagtcctgt cgggtttcgc cacctctgac ttgagcgtcg atttttgtga tgctcgtcag
     2581 gggggcggag cctatggaaa aacgccagca acgcggcctt tttacggttc ctggcctttt
     2641 gctggccttt tgctcacatg ttctttcctg cgttatcccc tgattctgtg gataaccgta
     2701 ttaccgcctt tgagtgagct gataccgctc gccgcagccg aacgaccgag cgcagcgagt
     2761 cagtgagcga ggaagcggaa gagcgcctga tgcggtattt tctccttacg catctgtgcg
     2821 gtatttcaca ccgcatatgg tgcactctca gtacaatctg ctctgatgcc gcatagttaa
     2881 gccagtatac actccgctat cgctacgtga ctgggtcatg gctgcgcccc gacacccgcc
     2941 aacacccgct gacgcgccct gacgggcttg tctgctcccg gcatccgctt acagacaagc
     3001 tgtgaccgtc tccgggagct gcatgtgtca gaggttttca ccgtcatcac cgaaacgcgc
     3061 gaggcagcag atcaattcgc gcgcgaaggc gaagcggcat gcataatgtg cctgtcaaat
     3121 ggacgaagca gggattctgc aaaccctatg ctactccgtc aagccgtcaa ttgtctgatt
     3181 cgttaccaat tatgacaact tgacggctac atcattcact ttttcttcac aaccggcacg
     3241 gaactcgctc gggctggccc cggtgcattt tttaaatacc cgcgagaaat agagttgatc
     3301 gtcaaaacca acattgcgac cgacggtggc gataggcatc cgggtggtgc tcaaaagcag
     3361 cttcgcctgg ctgatacgtt ggtcctcgcg ccagcttaag acgctaatcc ctaactgctg
     3421 gcggaaaaga tgtgacagac gcgacggcga caagcaaaca tgctgtgcga cgctggcgat
     3481 atcaaaattg ctgtctgcca ggtgatcgct gatgtactga caagcctcgc gtacccgatt
     3541 atccatcggt ggatggagcg actcgttaat cgcttccatg cgccgcagta acaattgctc
     3601 aagcagattt atcgccagca gctccgaata gcgcccttcc ccttgcccgg cgttaatgat
     3661 ttgcccaaac aggtcgctga aatgcggctg gtgcgcttca tccgggcgaa agaaccccgt
     3721 attggcaaat attgacggcc agttaagcca ttcatgccag taggcgcgcg gacgaaagta
     3781 aacccactgg tgataccatt cgcgagcctc cggatgacga ccgtagtgat gaatctctcc
     3841 tggcgggaac agcaaaatat cacccggtcg gcaaacaaat tctcgtccct gatttttcac
     3901 caccccctga ccgcgaatgg tgagattgag aatataacct ttcattccca gcggtcggtc
     3961 gataaaaaaa tcgagataac cgttggcctc aatcggcgtt aaacccgcca ccagatgggc
     4021 attaaacgag tatcccggca gcaggggatc attttgcgct tcagccatac ttttcatact
     4081 cccgccattc agag
//

 

Caution:
Product is for research use only!

 

Search name

pBAD/Myc-HisA,Plasmid pBAD/Myc-HisA,pBAD/Myc-HisA vector

No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart