pBARGPE1- EGFP

$293.00

  • Model: PVT11335
  • 50 Units in Stock
Ask a question


Add to Cart:

pBARGPE1-EGFP

Catalog No. PVT11335
Packing 2ug


pBARGPE1-EGFP Information

Promoter: gpdA, TrpC

Replicon: pUC ori

Terminator: trpC

Plasmid classification: other host shuttle vectors; filamentous fungi expressing plasmids.

Plasmid size: 6226bp

Plasmid label: enhanced green fluorescent protein EGFP

Prokaryotic resistance: ampicillin Ampicillin

Screening markers: LP Bar

Cloned strain: DH5 alpha

Culture conditions: 37 centigrade, aerobic, LB

Expression host: filamentous fungi

Training conditions: according to the literature operation

Induction mode: no induction

5'sequencing primers: Based on full sequence design

3'sequencing primers: Based on full sequence design

 

pBARGPE1-EGFP Description

PBARGPE1-EGFP is a filamentous fungus - Escherichia coli shuttle expression vector, which can use gpdA promoter to activate the expression of foreign gene, and can be transformed into filamentous fungi to be screened by gpdA.

pBARGPE1-EGFP

 

pBARGPE1-EGFP Sequence

LOCUS       Exported                6226 bp ds-DNA     circular SYN 30-AUG-2016

DEFINITION  synthetic circular DNA

ACCESSION   .

VERSION     .

KEYWORDS    pBARGPE1-EGFP

SOURCE      synthetic DNA construct

  ORGANISM  synthetic DNA construct

REFERENCE   1  (bases 1 to 6226)

  AUTHORS   .

  TITLE     Direct Submission

  JOURNAL   Exported Tuesday, August 30, 2016 from SnapGene Viewer 3.1.4

FEATURES             Location/Qualifiers

     source          1..6226

                     /organism="synthetic DNA construct"

                     /mol_type="other DNA"

     primer_bind     18..34

                     /note="KS primer"

                     /note="common sequencing primer, one of multiple similar 

                     variants"

     CDS             complement(55..774)

                     /codon_start=1

                     /product="enhanced GFP"

                     /note="EGFP"

                     /note="mammalian codon-optimized"

                     /translation="MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTL

                     KFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDD

                     GNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIK

                     VNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLL

                     EFVTAAGITLGMDELYK"

     primer_bind     789..805

                     /note="KS primer"

                     /note="common sequencing primer, one of multiple similar 

                     variants"

     misc_feature    complement(855..1539)

                     /note="gpdA Promoter"

     misc_feature    1754..1894

                     /note="bom"

                     /note="basis of mobility region from pBR322"

     rep_origin      complement(2080..2668)

                     /direction=LEFT

                     /note="ori"

                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 

                     replication"

     CDS             complement(2839..3699)

                     /codon_start=1

                     /gene="bla"

                     /product="beta-lactamase"

                     /note="AmpR"

                     /note="confers resistance to ampicillin, carbenicillin, and

                     related antibiotics"

                     /translation="[TEM beta-lactamase fragment, 45 aa]

                     ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVEYS

                     [TEM beta-lactamase fragment, 59 aa]

                     EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA

                     [TEM beta-lactamase fragment, 59 aa]

                     LIKHW"

     promoter        complement(3700..3804)

                     /gene="bla"

                     /note="AmpR promoter"

     promoter        3910..4011

                     /gene="S. cerevisiae TRP1"

                     /note="TRP1 promoter"

     misc_feature    4102..4487

                     /note="TrpC Promotor"

     CDS             4488..5039

                     /codon_start=1

                     /gene="Streptomyces hygroscopicus bar"

                     /product="phosphinothricin acetyltransferase"

                     /note="Bar"

                     /note="confers resistance to bialophos or phosphinothricin"

                     /translation="MSPERRPADIRRATEADMPAVCTIVNHYIETSTVNFRTEPQEPQE

                     WTDDLVRLRERYPWLVAEVDGEVAGIAYAGPWKARNAYDWTAESTVYVSPRHQRTGLGS

                     TLYTHLLKSLEAQGFKSVVAVIGLPNDPSVRMHEALGYAPRGMLRAAGFKHGNWHDVGF

                     WQLDFSLPVPPRPVLPVTEI"

     protein_bind    5431..5464

                     /bound_moiety="Cre recombinase"

                     /note="loxP"

                     /note="Cre-mediated recombination occurs in the 8-bp core 

                     sequence (GCATACAT)."

     protein_bind    5542..5575

                     /bound_moiety="Cre recombinase"

                     /note="loxP"

                     /note="Cre-mediated recombination occurs in the 8-bp core 

                     sequence (GCATACAT)."

     misc_feature    5969..6199

                     /note="trpC terminator"

ORIGIN

        1 ggtaccgggc cccccctcga ggtcgacggt atcgataagc ttgatatcga attcttactt

       61 gtacagctcg tccatgccga gagtgatccc ggcggcggtc acgaactcca gcaggaccat

      121 gtgatcgcgc ttctcgttgg ggtctttgct cagggcggac tgggtgctca ggtagtggtt

      181 gtcgggcagc agcacggggc cgtcgccgat gggggtgttc tgctggtagt ggtcggcgag

      241 ctgcacgctg ccgtcctcga tgttgtggcg gatcttgaag ttcaccttga tgccgttctt

      301 ctgcttgtcg gccatgatat agacgttgtg gctgttgtag ttgtactcca gcttgtgccc

      361 caggatgttg ccgtcctcct tgaagtcgat gcccttcagc tcgatgcggt tcaccagggt

      421 gtcgccctcg aacttcacct cggcgcgggt cttgtagttg ccgtcgtcct tgaagaagat

      481 ggtgcgctcc tggacgtagc cttcgggcat ggcggacttg aagaagtcgt gctgcttcat

      541 gtggtcgggg tagcggctga agcactgcac gccgtaggtc agggtggtca cgagggtggg

      601 ccagggcacg ggcagcttgc cggtggtgca gatgaacttc agggtcagct tgccgtaggt

      661 ggcatcgccc tcgccctcgc cggacacgct gaacttgtgg ccgtttacgt cgccgtccag

      721 ctcgaccagg atgggcacca ccccggtgaa cagctcctcg cccttgctca ccatggatcc

      781 tctagagtcg aggtcgacgg tatcgataag cttgattaaa ggttcttgga tgggaagatg

      841 aatatactga agatgggaaa agaaagagaa aagaaaagag cagctggtgg ggagagcagg

      901 aaaatatggc aacaaatgtt ggactgacgc aacgaccttg tcaaccccgc cgacacaccg

      961 ggcggacaga cggggcaaag ctgcctacca gggactgagg gacctcagca ggtcgagtgc

     1021 agagcaccgg atgggtcgac tgccagcttg tgttcccggt ctgcgccgct ggccagctcc

     1081 tgagcggcct ttccggtttc atacaccggg caaagcagga gaggcacgat atttggacgc

     1141 cctacagatg ccggatgggc caattaggga gcttacgcgc cgggtactcg ctctacctac

     1201 ttcggagaag gtactatctc gtgaatcttt taccagatcg gaagcaattg gacttctgta

     1261 cctaggttaa tggcatgcta tttcgccgac ggctatacac ccctggcttc acattctcct

     1321 tcgcttactg ccggtgattc gatgaagctc catattctcc gatgatgcaa tagattcttg

     1381 gtcaacgagg ggcacaccag cctttccact tcggggcgga ggggcggccg gtcccggatt

     1441 aataatcatc cactgcacct cagagccgcc agagctgtct ggcgcagtgg cgcttattac

     1501 tcagcccttc tctctgcgtc cgtccgtctc tccgcatgct ttgcatactt ctgcctgctg

     1561 gggagcctgg ggactttcca caccctaact gacacacatt ccacagagat ctctgcctcg

     1621 cgcgtttcgg tgatgacggt gaaaacctct gacacatgca gctcccggag acggtcacag

     1681 cttgtctgta agcggatgcc gggagcagac aagcccgtca gggcgcgtca gcgggtgttg

     1741 gcgggtgtcg gggcgcagcc atgacccagt cacgtagcga tagcggagtg tatactggct

     1801 taactatgcg gcatcagagc agattgtact gagagtgcac catatgcggt gtgaaatacc

     1861 gcacagatgc gtaaggagaa aataccgcat caggcgctct tccgcttcct cgctcactga

     1921 ctcgctgcgc tcggtcgttc ggctgcggcg agcggtatca gctcactcaa aggcggtaat

     1981 acggttatcc acagaatcag gggataacgc aggaaagaac atgtgagcaa aaggccagca

     2041 aaaggccagg aaccgtaaaa aggccgcgtt gctggcgttt ttccataggc tccgcccccc

     2101 tgacgagcat cacaaaaatc gacgctcaag tcagaggtgg cgaaacccga caggactata

     2161 aagataccag gcgtttcccc ctggaagctc cctcgtgcgc tctcctgttc cgaccctgcc

     2221 gcttaccgga tacctgtccg cctttctccc ttcgggaagc gtggcgcttt ctcatagctc

     2281 acgctgtagg tatctcagtt cggtgtaggt cgttcgctcc aagctgggct gtgtgcacga

     2341 accccccgtt cagcccgacc gctgcgcctt atccggtaac tatcgtcttg agtccaaccc

     2401 ggtaagacac gacttatcgc cactggcagc agccactggt aacaggatta gcagagcgag

     2461 gtatgtaggc ggtgctacag agttcttgaa gtggtggcct aactacggct acactagaag

     2521 aacagtattt ggtatctgcg ctctgctgaa gccagttacc ttcggaaaaa gagttggtag

     2581 ctcttgatcc ggcaaacaaa ccaccgctgg tagcggtggt ttttttgttt gcaagcagca

     2641 gattacgcgc agaaaaaaag gatctcaaga agatcctttg atcttttcta cggggtctga

     2701 cgctcagtgg aacgaaaact cacgttaagg gattttggtc atgagattat caaaaaggat

     2761 cttcacctag atccttttaa attaaaaatg aagttttaaa tcaatctaaa gtatatatga

     2821 gtaaacttgg tctgacagtt accaatgctt aatcagtgag gcacctatct cagcgatctg

     2881 tctatttcgt tcatccatag ttgcctgact ccccgtcgtg tagataacta cgatacggga

     2941 gggcttacca tctggcccca gtgctgcaat gataccgcga gacccacgct caccggctcc

     3001 agatttatca gcaataaacc agccagccgg aagggccgag cgcagaagtg gtcctgcaac

     3061 tttatccgcc tccatccagt ctattaattg ttgccgggaa gctagagtaa gtagttcgcc

     3121 agttaatagt ttgcgcaacg ttgttgccat tgctacaggc atcgtggtgt cacgctcgtc

     3181 gtttggtatg gcttcattca gctccggttc ccaacgatca aggcgagtta catgatcccc

     3241 catgttgtgc aaaaaagcgg ttagctcctt cggtcctccg atcgttgtca gaagtaagtt

     3301 ggccgcagtg ttatcactca tggttatggc agcactgcat aattctctta ctgtcatgcc

     3361 atccgtaaga tgcttttctg tgactggtga gtactcaacc aagtcattct gagaatagtg

     3421 tatgcggcga ccgagttgct cttgcccggc gtcaatacgg gataataccg cgccacatag

     3481 cagaacttta aaagtgctca tcattggaaa acgttcttcg gggcgaaaac tctcaaggat

     3541 cttaccgctg ttgagatcca gttcgatgta acccactcgt gcacccaact gatcttcagc

     3601 atcttttact ttcaccagcg tttctgggtg agcaaaaaca ggaaggcaaa atgccgcaaa

     3661 aaagggaata agggcgacac ggaaatgttg aatactcata ctcttccttt ttcaatatta

     3721 ttgaagcatt tatcagggtt attgtctcat gagcggatac atatttgaat gtatttagaa

     3781 aaataaacaa ataggggttc cgcgcacatt tccccgaaaa gtgccacctg acgtctaaga

     3841 aaccattatt atcatgacat taacctataa aaataggcgt atcacgaggc cctttcgtct

     3901 tcaagaatta attcggtcga aaaaagaaaa ggagagggcc aagagggagg gcattggtga

     3961 ctattgagca cgtgagtata cgtgattaag cacacaaagg cagcttggag tatgtctgtt

     4021 attaatttca caggtagttc tggtccattg gtgaaagttt gcggcttgca gagcacagag

     4081 gccgcagaat gtgctctaga ctcgacagaa gatgatattg aaggagcact ttttgggctt

     4141 ggctggagct agtggaggtc aacaatgaat gcctattttg gtttagtcgt ccaggcggtg

     4201 agcacaaaat ttgtgtcgtt tgacaagatg gttcatttag gcaactggtc agatcagccc

     4261 cacttgtagc agtagcggcg gcgctcgaag tgtgactctt attagcagac aggaacgagg

     4321 acattattat catctgctgc ttggtgcacg ataacttggt gcgtttgtca agcaaggtaa

     4381 gtgaacgacc cggtcatacc ttcttaagtt cgcccttcct ccctttattt cagattcaat

     4441 ctgacttacc tattctaccc aagcaaagct tcgattagga agtaaccatg agcccagaac

     4501 gacgcccggc cgacatccgc cgtgccaccg aggcggacat gccggcggtc tgcaccatcg

     4561 tcaaccacta catcgagaca agcacggtca acttccgtac cgagccgcag gaaccgcagg

     4621 agtggacgga cgacctcgtc cgtctgcggg agcgctatcc ctggctcgtc gccgaggtgg

     4681 acggcgaggt cgccggcatc gcctacgcgg gcccctggaa ggcacgcaac gcctacgact

     4741 ggacggccga gtcgaccgtg tacgtctccc cccgccacca gcggacggga ctgggctcca

     4801 cgctctacac ccacctgctg aagtccctgg aggcacaggg cttcaagagc gtggtcgctg

     4861 tcatcgggct gcccaacgac ccgagcgtgc gcatgcacga ggcgctcgga tatgcccccc

     4921 gcggcatgct gcgggcggcc ggcttcaagc acgggaactg gcatgacgtg ggtttctggc

     4981 agctggactt cagcctgccg gtaccgcccc gtccggtcct gcccgtcacc gagatctgat

     5041 ccgtcgacct gcagatcgtt caaacatttg gcaataaagt ttcttaagat tgaatcctgt

     5101 tgccggtctt gcgatgatta tcatataatt tctgttgaat tacgttaagc atgtaataat

     5161 taacatgtaa tgcatagtac cgagaaacta gtggatctaa acataaaatc tgtaaaataa

     5221 caagatgtaa agataatgct aaatcatttg gctttttgat tgattgtaca ggaaaatata

     5281 catcgcaggg ggttgacttt taccatttca ccgcaatgga atcaaacttg ttgaagagaa

     5341 tgttcacagg cgcatacgct acaatgaccc gattcttgct agccttttct cggtcttgca

     5401 aacaaccgcc gcggccggtc gagggaccta ataacttcgt atagcataca ttatacgaag

     5461 ttatattaag ggttccggat cgcggccgct cgacctgcag ccaagctagc ttggctggac

     5521 gtaaactcct cttcagacct aataacttcg tatagcatac attatacgaa gttatattaa

     5581 gggttattga atatgatcgg aattggtcga tcaggtattg ctgttatctg atgagtatac

     5641 gttgtcctgg ccacggcaga agcacgctta tcgctccaat ttcccacaac attagtcaac

     5701 tccgttaggc ccttcattga aagaaatgag gtcatcaaat gtcttccaat gtgagatttt

     5761 gggccatttt ttatagcaaa gattgaataa ggcgcatttt tcttcaaagc ttgcaaatta

     5821 aagccttcga gcgtcccaaa accttctcaa gcaaggtttt cagtataatg ttacatgcgt

     5881 acacgcgcta tattttgttt tctatcgcgt attaaatgta taattgcggg actctaatca

     5941 taaaaaccca tctcataaat aacgtcatgc attgcagatg agctgtatct ggaagaggta

     6001 aacccgaaac gcgttttatt cttgttgaca tggagctatt aaatcactag aaggcactct

     6061 ttgctgcttg gacaaatgaa cgtatcttat cgagatcctg aacaccattt gtctcaactc

     6121 cggagctgac atcgacacca acgatcttat atccagattc gtcaagctgt ttgatgattt

     6181 cagtaacgtt aagtggatct cggtgacggg caggaccgga cggggc

//

No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart