pBARGPE1- Hygro- EGFP Plasmid

$216.00

  • Model: PVT5307
  • 50 Units in Stock
Ask a question


Add to Cart:

pBARGPE1- Hygro- EGFP Plasmid

PVT5307  2ug

 

pBARGPE1-Hygro-EGFP Information

Promoter: gpdA, TrpC

Replicon: pUC ori

Terminator: trpC

Plasmid classification: other host shuttle vectors; filamentous fungi expressing plasmids.

Plasmid size: 6700bp

Plasmid label: enhanced green fluorescent protein EGFP

Prokaryotic resistance: ampicillin Ampicillin

Screening markers: hygromycin Hygromycin

Cloned strain: DH5 alpha

Culture conditions: 37 centigrade, aerobic, LB

Expression host: filamentous fungi

5'sequencing primers: Based on full sequence design

3'sequencing primers: Based on full sequence design

Note: the expression of EGFP fusion protein

Use:Filamentous fungal plasmid

 

pBARGPE1-Hygro-EGFP Description

PBARGPE1-Hygro-EGFP is a filamentous fungus - Escherichia coli shuttle expression vector. The expression of exogenous target gene can be activated by gpdA promoter, and it can be transformed into filamentous fungi to be screened by hygromycin Hygromycin.

pBARGPE1-Hygro-EGFP-vector-map

 

 

pBARGPE1-Hygro-EGFP Sequence

LOCUS       Exported                6700 bp ds-DNA     circular SYN 15-AUG-2018

DEFINITION  synthetic circular DNA

KEYWORDS    pBARGPE1-Hygro-EGFP

SOURCE      synthetic DNA construct

  ORGANISM  synthetic DNA construct

REFERENCE   1  (bases 1 to 6700)

  TITLE     Direct Submission

FEATURES             Location/Qualifiers

     source          1..6700

                     /organism="synthetic DNA construct"

                     /mol_type="other DNA"

     CDS             complement(55..774)

                     /codon_start=1

                     /product="enhanced GFP"

                     /note="EGFP"

                     /note="mammalian codon-optimized"

                     /translation="MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTL

                     KFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDD

                     GNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIK

                     VNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLL

                     EFVTAAGITLGMDELYK"

     misc_feature    complement(854..1539)

                     /note="gpdA Promoter"

     misc_feature    1754..1894

                     /note="bom"

                     /note="basis of mobility region from pBR322"

     rep_origin      complement(2080..2668)

                     /direction=LEFT

                     /note="ori"

                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 

                     replication"

     CDS             complement(2839..3699)

                     /codon_start=1

                     /gene="bla"

                     /product="beta-lactamase"

                     /note="AmpR"

                     /note="confers resistance to ampicillin, carbenicillin, and

                     related antibiotics"

                     /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI

                     ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVEYS

                     PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW

                     EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA

                     LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS

                     LIKHW"

     promoter        complement(3700..3804)

                     /gene="bla"

                     /note="AmpR promoter"

     misc_feature    4102..4487

                     /note="TrpC Promotor"

     CDS             4488..5513

                     /codon_start=1

                     /gene="aph(4)-Ia"

                     /product="aminoglycoside phosphotransferase from E. coli"

                     /note="HygR"

                     /note="confers resistance to hygromycin"

                     /translation="MKKPELTATSVEKFLIEKFDSVSDLMQLSEGEESRAFSFDVGGRG

                     YVLRVNSCADGFYKDRYVYRHFASAALPIPEVLDIGEFSESLTYCISRRAQGVTLQDLP

                     ETELPAVLQPVAEAMDAIAAADLSQTSGFGPFGPQGIGQYTTWRDFICAIADPHVYHWQ

                     TVMDDTVSASVAQALDELMLWAEDCPEVRHLVHADFGSNNVLTDNGRITAVIDWSEAMF

                     GDSQYEVANIFFWRPWLACMEQQTRYFERRHPELAGSPRLRAYMLRIGLDQLYQSLVDG

                     NFDDAAWAQGRCDAIVRSGAGTVGRTQIARRSAAVWTDGCVEVLADSGNRRPSTRPRAK

                     K"

     protein_bind    5905..5938

                     /bound_moiety="Cre recombinase"

                     /note="loxP"

                     /note="Cre-mediated recombination occurs in the 8-bp core 

                     sequence (GCATACAT)."

     protein_bind    6016..6049

                     /bound_moiety="Cre recombinase"

                     /note="loxP"

                     /note="Cre-mediated recombination occurs in the 8-bp core 

                     sequence (GCATACAT)."

     misc_feature    6442..6673

                     /note="trpC terminator"

ORIGIN

        1 ggtaccgggc cccccctcga ggtcgacggt atcgataagc ttgatatcga attcttactt

       61 gtacagctcg tccatgccga gagtgatccc ggcggcggtc acgaactcca gcaggaccat

      121 gtgatcgcgc ttctcgttgg ggtctttgct cagggcggac tgggtgctca ggtagtggtt

      181 gtcgggcagc agcacggggc cgtcgccgat gggggtgttc tgctggtagt ggtcggcgag

      241 ctgcacgctg ccgtcctcga tgttgtggcg gatcttgaag ttcaccttga tgccgttctt

      301 ctgcttgtcg gccatgatat agacgttgtg gctgttgtag ttgtactcca gcttgtgccc

      361 caggatgttg ccgtcctcct tgaagtcgat gcccttcagc tcgatgcggt tcaccagggt

      421 gtcgccctcg aacttcacct cggcgcgggt cttgtagttg ccgtcgtcct tgaagaagat

      481 ggtgcgctcc tggacgtagc cttcgggcat ggcggacttg aagaagtcgt gctgcttcat

      541 gtggtcgggg tagcggctga agcactgcac gccgtaggtc agggtggtca cgagggtggg

      601 ccagggcacg ggcagcttgc cggtggtgca gatgaacttc agggtcagct tgccgtaggt

      661 ggcatcgccc tcgccctcgc cggacacgct gaacttgtgg ccgtttacgt cgccgtccag

      721 ctcgaccagg atgggcacca ccccggtgaa cagctcctcg cccttgctca ccatggatcc

      781 tctagagtcg aggtcgacgg tatcgataag cttgattaaa ggttcttgga tgggaagatg

      841 aatatactga agatgggaaa agaaagagaa aagaaaagag cagctggtgg ggagagcagg

      901 aaaatatggc aacaaatgtt ggactgacgc aacgaccttg tcaaccccgc cgacacaccg

      961 ggcggacaga cggggcaaag ctgcctacca gggactgagg gacctcagca ggtcgagtgc

     1021 agagcaccgg atgggtcgac tgccagcttg tgttcccggt ctgcgccgct ggccagctcc

     1081 tgagcggcct ttccggtttc atacaccggg caaagcagga gaggcacgat atttggacgc

     1141 cctacagatg ccggatgggc caattaggga gcttacgcgc cgggtactcg ctctacctac

     1201 ttcggagaag gtactatctc gtgaatcttt taccagatcg gaagcaattg gacttctgta

     1261 cctaggttaa tggcatgcta tttcgccgac ggctatacac ccctggcttc acattctcct

     1321 tcgcttactg ccggtgattc gatgaagctc catattctcc gatgatgcaa tagattcttg

     1381 gtcaacgagg ggcacaccag cctttccact tcggggcgga ggggcggccg gtcccggatt

     1441 aataatcatc cactgcacct cagagccgcc agagctgtct ggcgcagtgg cgcttattac

     1501 tcagcccttc tctctgcgtc cgtccgtctc tccgcatgct ttgcatactt ctgcctgctg

     1561 gggagcctgg ggactttcca caccctaact gacacacatt ccacagagat ctctgcctcg

     1621 cgcgtttcgg tgatgacggt gaaaacctct gacacatgca gctcccggag acggtcacag

     1681 cttgtctgta agcggatgcc gggagcagac aagcccgtca gggcgcgtca gcgggtgttg

     1741 gcgggtgtcg gggcgcagcc atgacccagt cacgtagcga tagcggagtg tatactggct

     1801 taactatgcg gcatcagagc agattgtact gagagtgcac catatgcggt gtgaaatacc

     1861 gcacagatgc gtaaggagaa aataccgcat caggcgctct tccgcttcct cgctcactga

     1921 ctcgctgcgc tcggtcgttc ggctgcggcg agcggtatca gctcactcaa aggcggtaat

     1981 acggttatcc acagaatcag gggataacgc aggaaagaac atgtgagcaa aaggccagca

     2041 aaaggccagg aaccgtaaaa aggccgcgtt gctggcgttt ttccataggc tccgcccccc

     2101 tgacgagcat cacaaaaatc gacgctcaag tcagaggtgg cgaaacccga caggactata

     2161 aagataccag gcgtttcccc ctggaagctc cctcgtgcgc tctcctgttc cgaccctgcc

     2221 gcttaccgga tacctgtccg cctttctccc ttcgggaagc gtggcgcttt ctcatagctc

     2281 acgctgtagg tatctcagtt cggtgtaggt cgttcgctcc aagctgggct gtgtgcacga

     2341 accccccgtt cagcccgacc gctgcgcctt atccggtaac tatcgtcttg agtccaaccc

     2401 ggtaagacac gacttatcgc cactggcagc agccactggt aacaggatta gcagagcgag

     2461 gtatgtaggc ggtgctacag agttcttgaa gtggtggcct aactacggct acactagaag

     2521 aacagtattt ggtatctgcg ctctgctgaa gccagttacc ttcggaaaaa gagttggtag

     2581 ctcttgatcc ggcaaacaaa ccaccgctgg tagcggtggt ttttttgttt gcaagcagca

     2641 gattacgcgc agaaaaaaag gatctcaaga agatcctttg atcttttcta cggggtctga

     2701 cgctcagtgg aacgaaaact cacgttaagg gattttggtc atgagattat caaaaaggat

     2761 cttcacctag atccttttaa attaaaaatg aagttttaaa tcaatctaaa gtatatatga

     2821 gtaaacttgg tctgacagtt accaatgctt aatcagtgag gcacctatct cagcgatctg

     2881 tctatttcgt tcatccatag ttgcctgact ccccgtcgtg tagataacta cgatacggga

     2941 gggcttacca tctggcccca gtgctgcaat gataccgcga gacccacgct caccggctcc

     3001 agatttatca gcaataaacc agccagccgg aagggccgag cgcagaagtg gtcctgcaac

     3061 tttatccgcc tccatccagt ctattaattg ttgccgggaa gctagagtaa gtagttcgcc

     3121 agttaatagt ttgcgcaacg ttgttgccat tgctacaggc atcgtggtgt cacgctcgtc

     3181 gtttggtatg gcttcattca gctccggttc ccaacgatca aggcgagtta catgatcccc

     3241 catgttgtgc aaaaaagcgg ttagctcctt cggtcctccg atcgttgtca gaagtaagtt

     3301 ggccgcagtg ttatcactca tggttatggc agcactgcat aattctctta ctgtcatgcc

     3361 atccgtaaga tgcttttctg tgactggtga gtactcaacc aagtcattct gagaatagtg

     3421 tatgcggcga ccgagttgct cttgcccggc gtcaatacgg gataataccg cgccacatag

     3481 cagaacttta aaagtgctca tcattggaaa acgttcttcg gggcgaaaac tctcaaggat

     3541 cttaccgctg ttgagatcca gttcgatgta acccactcgt gcacccaact gatcttcagc

     3601 atcttttact ttcaccagcg tttctgggtg agcaaaaaca ggaaggcaaa atgccgcaaa

     3661 aaagggaata agggcgacac ggaaatgttg aatactcata ctcttccttt ttcaatatta

     3721 ttgaagcatt tatcagggtt attgtctcat gagcggatac atatttgaat gtatttagaa

     3781 aaataaacaa ataggggttc cgcgcacatt tccccgaaaa gtgccacctg acgtctaaga

     3841 aaccattatt atcatgacat taacctataa aaataggcgt atcacgaggc cctttcgtct

     3901 tcaagaatta attcggtcga aaaaagaaaa ggagagggcc aagagggagg gcattggtga

     3961 ctattgagca cgtgagtata cgtgattaag cacacaaagg cagcttggag tatgtctgtt

     4021 attaatttca caggtagttc tggtccattg gtgaaagttt gcggcttgca gagcacagag

     4081 gccgcagaat gtgctctaga ctcgacagaa gatgatattg aaggagcact ttttgggctt

     4141 ggctggagct agtggaggtc aacaatgaat gcctattttg gtttagtcgt ccaggcggtg

     4201 agcacaaaat ttgtgtcgtt tgacaagatg gttcatttag gcaactggtc agatcagccc

     4261 cacttgtagc agtagcggcg gcgctcgaag tgtgactctt attagcagac aggaacgagg

     4321 acattattat catctgctgc ttggtgcacg ataacttggt gcgtttgtca agcaaggtaa

     4381 gtgaacgacc cggtcatacc ttcttaagtt cgcccttcct ccctttattt cagattcaat

     4441 ctgacttacc tattctaccc aagcaaagct tcgattagga agtaaccatg aaaaagcctg

     4501 aactcaccgc gacgtctgtc gagaagtttc tgatcgaaaa gttcgacagc gtctccgacc

     4561 tgatgcagct ctcggagggc gaagaatctc gtgctttcag cttcgatgta ggagggcgtg

     4621 gatatgtcct gcgggtaaat agctgcgccg atggtttcta caaagatcgt tatgtttatc

     4681 ggcactttgc atcggccgcg ctcccgattc cggaagtgct tgacattggg gagtttagcg

     4741 agagcctgac ctattgcatc tcccgccgtg cacagggtgt cacgttgcaa gacctgcctg

     4801 aaaccgaact gcccgctgtt ctacaaccgg tcgcggaggc tatggatgcg atcgctgcgg

     4861 ccgatcttag ccagacgagc gggttcggcc cattcggacc gcaaggaatc ggtcaataca

     4921 ctacatggcg tgatttcata tgcgcgattg ctgatcccca tgtgtatcac tggcaaactg

     4981 tgatggacga caccgtcagt gcgtccgtcg cgcaggctct cgatgagctg atgctttggg

     5041 ccgaggactg ccccgaagtc cggcacctcg tgcacgcgga tttcggctcc aacaatgtcc

     5101 tgacggacaa tggccgcata acagcggtca ttgactggag cgaggcgatg ttcggggatt

     5161 cccaatacga ggtcgccaac atcttcttct ggaggccgtg gttggcttgt atggagcagc

     5221 agacgcgcta cttcgagcgg aggcatccgg agcttgcagg atcgccacga ctccgggcgt

     5281 atatgctccg cattggtctt gaccaactct atcagagctt ggttgacggc aatttcgatg

     5341 atgcagcttg ggcgcagggt cgatgcgacg caatcgtccg atccggagcc gggactgtcg

     5401 ggcgtacaca aatcgcccgc agaagcgcgg ccgtctggac cgatggctgt gtagaagtac

     5461 tcgccgatag tggaaaccga cgccccagca ctcgtccgag ggcaaagaaa tagtccgtcg

     5521 acctgcagat cgttcaaaca tttggcaata aagtttctta agattgaatc ctgttgccgg

     5581 tcttgcgatg attatcatat aatttctgtt gaattacgtt aagcatgtaa taattaacat

     5641 gtaatgcata gtaccgagaa actagtggat ctaaacataa aatctgtaaa ataacaagat

     5701 gtaaagataa tgctaaatca tttggctttt tgattgattg tacaggaaaa tatacatcgc

     5761 agggggttga cttttaccat ttcaccgcaa tggaatcaaa cttgttgaag agaatgttca

     5821 caggcgcata cgctacaatg acccgattct tgctagcctt ttctcggtct tgcaaacaac

     5881 cgccgcggcc ggtcgaggga cctaataact tcgtatagca tacattatac gaagttatat

     5941 taagggttcc ggatcgcggc cgctcgacct gcagccaagc tagcttggct ggacgtaaac

     6001 tcctcttcag acctaataac ttcgtatagc atacattata cgaagttata ttaagggtta

     6061 ttgaatatga tcggaattgg tcgatcaggt attgctgtta tctgatgagt atacgttgtc

     6121 ctggccacgg cagaagcacg cttatcgctc caatttccca caacattagt caactccgtt

     6181 aggcccttca ttgaaagaaa tgaggtcatc aaatgtcttc caatgtgaga ttttgggcca

     6241 ttttttatag caaagattga ataaggcgca tttttcttca aagcttgcaa attaaagcct

     6301 tcgagcgtcc caaaaccttc tcaagcaagg ttttcagtat aatgttacat gcgtacacgc

     6361 gctatatttt gttttctatc gcgtattaaa tgtataattg cgggactcta atcataaaaa

     6421 cccatctcat aaataacgtc atgcattgca gatgagctgt atctggaaga ggtaaacccg

     6481 aaacgcgttt tattcttgtt gacatggagc tattaaatca ctagaaggca ctctttgctg

     6541 cttggacaaa tgaacgtatc ttatcgagat cctgaacacc atttgtctca actccggagc

     6601 tgacatcgac accaacgatc ttatatccag attcgtcaag ctgtttgatg atttcagtaa

     6661 cgttaagtgg atctcggtga cgggcaggac cggacggggc

//

Caution 

Product is for research use only!
 

Search name

pBARGPE1-Hygro-EGFP,Plasmid pBARGPE1-Hygro-EGFP,pBARGPE1-Hygro-EGFP vector

No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart