pBARGPE1- Hygro

$216.00

  • Model: PVT5306
  • 50 Units in Stock
Ask a question


Add to Cart:

pBARGPE1-Hygro

PVT5306      2ug
 

pBARGPE1-Hygro Information

Promoter: gpdA, TrpC

Replicon: pUC ori

Terminator: trpC

Plasmid classification: other host shuttle vectors; filamentous fungi expressing plasmids.

Plasmid size: 5992bp

Prokaryotic resistance: ampicillin Ampicillin

Screening markers: hygromycin Hygromycin

Cloned strain: DH5 alpha

Culture conditions: 37 centigrade, aerobic, LB

Expression host: filamentous fungi

Induction mode: no induction

5'sequencing primers: Based on full sequence design

3'sequencing primers: Based on full sequence design

 

pBARGPE1-Hygro Description

PBARGPE1-Hygro is a filamentous fungus - Escherichia coli shuttle expression vector. The expression of exogenous target gene can be activated by gpdA promoter, and it can be transformed into filamentous fungi to be screened by hygromycin Hygromycin.

pBARGPE1-Hygro-vector

 

pBARGPE1-Hygro Sequence

LOCUS       Exported                5992 bp ds-DNA     circular SYN 30-AUG-2016

DEFINITION  synthetic circular DNA

ACCESSION   .

VERSION     .

KEYWORDS    pBARGPE1-Hygro

SOURCE      synthetic DNA construct

  ORGANISM  synthetic DNA construct

REFERENCE   1  (bases 1 to 5992)

  AUTHORS   .

  TITLE     Direct Submission

  JOURNAL   Exported Tuesday, August 30, 2016 from SnapGene Viewer 3.1.4

FEATURES             Location/Qualifiers

     source          1..5992

                     /organism="synthetic DNA construct"

                     /mol_type="other DNA"

     primer_bind     18..34

                     /note="KS primer"

                     /note="common sequencing primer, one of multiple similar 

                     variants"

     primer_bind     81..97

                     /note="KS primer"

                     /note="common sequencing primer, one of multiple similar 

                     variants"

     misc_feature    complement(147..831)

                     /note="gpdA Promoter"

     misc_feature    1046..1186

                     /note="bom"

                     /note="basis of mobility region from pBR322"

     rep_origin      complement(1372..1960)

                     /direction=LEFT

                     /note="ori"

                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 

                     replication"

     CDS             complement(2131..2991)

                     /codon_start=1

                     /gene="bla"

                     /product="beta-lactamase"

                     /note="AmpR"

                     /note="confers resistance to ampicillin, carbenicillin, and

                     related antibiotics"

                     /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI

                     ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVEYS

                     PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW

                     EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA

                     LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS

                     LIKHW"

     promoter        complement(2992..3096)

                     /gene="bla"

                     /note="AmpR promoter"

     promoter        3202..3303

                     /gene="S. cerevisiae TRP1"

                     /note="TRP1 promoter"

     misc_feature    3394..3779

                     /note="TrpC Promotor"

     CDS             3780..4805

                     /codon_start=1

                     /gene="aph(4)-Ia"

                     /product="aminoglycoside phosphotransferase from E. coli"

                     /note="HygR"

                     /note="confers resistance to hygromycin"

                     /translation="MKKPELTATSVEKFLIEKFDSVSDLMQLSEGEESRAFSFDVGGRG

                     YVLRVNSCADGFYKDRYVYRHFASAALPIPEVLDIGEFSESLTYCISRRAQGVTLQDLP

                     ETELPAVLQPVAEAMDAIAAADLSQTSGFGPFGPQGIGQYTTWRDFICAIADPHVYHWQ

                     TVMDDTVSASVAQALDELMLWAEDCPEVRHLVHADFGSNNVLTDNGRITAVIDWSEAMF

                     GDSQYEVANIFFWRPWLACMEQQTRYFERRHPELAGSPRLRAYMLRIGLDQLYQSLVDG

                     NFDDAAWAQGRCDAIVRSGAGTVGRTQIARRSAAVWTDGCVEVLADSGNRRPSTRPRAK

                     K"

     protein_bind    5197..5230

                     /bound_moiety="Cre recombinase"

                     /note="loxP"

                     /note="Cre-mediated recombination occurs in the 8-bp core 

                     sequence (GCATACAT)."

     protein_bind    5308..5341

                     /bound_moiety="Cre recombinase"

                     /note="loxP"

                     /note="Cre-mediated recombination occurs in the 8-bp core 

                     sequence (GCATACAT)."

     misc_feature    5735..5965

                     /note="trpC terminator"

ORIGIN

        1 ggtaccgggc cccccctcga ggtcgacggt atcgataagc ttgatatcga attcctgcag

       61 cccgggggat cctctagagt cgaggtcgac ggtatcgata agcttgatta aaggttcttg

      121 gatgggaaga tgaatatact gaagatggga aaagaaagag aaaagaaaag agcagctggt

      181 ggggagagca ggaaaatatg gcaacaaatg ttggactgac gcaacgacct tgtcaacccc

      241 gccgacacac cgggcggaca gacggggcaa agctgcctac cagggactga gggacctcag

      301 caggtcgagt gcagagcacc ggatgggtcg actgccagct tgtgttcccg gtctgcgccg

      361 ctggccagct cctgagcggc ctttccggtt tcatacaccg ggcaaagcag gagaggcacg

      421 atatttggac gccctacaga tgccggatgg gccaattagg gagcttacgc gccgggtact

      481 cgctctacct acttcggaga aggtactatc tcgtgaatct tttaccagat cggaagcaat

      541 tggacttctg tacctaggtt aatggcatgc tatttcgccg acggctatac acccctggct

      601 tcacattctc cttcgcttac tgccggtgat tcgatgaagc tccatattct ccgatgatgc

      661 aatagattct tggtcaacga ggggcacacc agcctttcca cttcggggcg gaggggcggc

      721 cggtcccgga ttaataatca tccactgcac ctcagagccg ccagagctgt ctggcgcagt

      781 ggcgcttatt actcagccct tctctctgcg tccgtccgtc tctccgcatg ctttgcatac

      841 ttctgcctgc tggggagcct ggggactttc cacaccctaa ctgacacaca ttccacagag

      901 atctctgcct cgcgcgtttc ggtgatgacg gtgaaaacct ctgacacatg cagctcccgg

      961 agacggtcac agcttgtctg taagcggatg ccgggagcag acaagcccgt cagggcgcgt

     1021 cagcgggtgt tggcgggtgt cggggcgcag ccatgaccca gtcacgtagc gatagcggag

     1081 tgtatactgg cttaactatg cggcatcaga gcagattgta ctgagagtgc accatatgcg

     1141 gtgtgaaata ccgcacagat gcgtaaggag aaaataccgc atcaggcgct cttccgcttc

     1201 ctcgctcact gactcgctgc gctcggtcgt tcggctgcgg cgagcggtat cagctcactc

     1261 aaaggcggta atacggttat ccacagaatc aggggataac gcaggaaaga acatgtgagc

     1321 aaaaggccag caaaaggcca ggaaccgtaa aaaggccgcg ttgctggcgt ttttccatag

     1381 gctccgcccc cctgacgagc atcacaaaaa tcgacgctca agtcagaggt ggcgaaaccc

     1441 gacaggacta taaagatacc aggcgtttcc ccctggaagc tccctcgtgc gctctcctgt

     1501 tccgaccctg ccgcttaccg gatacctgtc cgcctttctc ccttcgggaa gcgtggcgct

     1561 ttctcatagc tcacgctgta ggtatctcag ttcggtgtag gtcgttcgct ccaagctggg

     1621 ctgtgtgcac gaaccccccg ttcagcccga ccgctgcgcc ttatccggta actatcgtct

     1681 tgagtccaac ccggtaagac acgacttatc gccactggca gcagccactg gtaacaggat

     1741 tagcagagcg aggtatgtag gcggtgctac agagttcttg aagtggtggc ctaactacgg

     1801 ctacactaga agaacagtat ttggtatctg cgctctgctg aagccagtta ccttcggaaa

     1861 aagagttggt agctcttgat ccggcaaaca aaccaccgct ggtagcggtg gtttttttgt

     1921 ttgcaagcag cagattacgc gcagaaaaaa aggatctcaa gaagatcctt tgatcttttc

     1981 tacggggtct gacgctcagt ggaacgaaaa ctcacgttaa gggattttgg tcatgagatt

     2041 atcaaaaagg atcttcacct agatcctttt aaattaaaaa tgaagtttta aatcaatcta

     2101 aagtatatat gagtaaactt ggtctgacag ttaccaatgc ttaatcagtg aggcacctat

     2161 ctcagcgatc tgtctatttc gttcatccat agttgcctga ctccccgtcg tgtagataac

     2221 tacgatacgg gagggcttac catctggccc cagtgctgca atgataccgc gagacccacg

     2281 ctcaccggct ccagatttat cagcaataaa ccagccagcc ggaagggccg agcgcagaag

     2341 tggtcctgca actttatccg cctccatcca gtctattaat tgttgccggg aagctagagt

     2401 aagtagttcg ccagttaata gtttgcgcaa cgttgttgcc attgctacag gcatcgtggt

     2461 gtcacgctcg tcgtttggta tggcttcatt cagctccggt tcccaacgat caaggcgagt

     2521 tacatgatcc cccatgttgt gcaaaaaagc ggttagctcc ttcggtcctc cgatcgttgt

     2581 cagaagtaag ttggccgcag tgttatcact catggttatg gcagcactgc ataattctct

     2641 tactgtcatg ccatccgtaa gatgcttttc tgtgactggt gagtactcaa ccaagtcatt

     2701 ctgagaatag tgtatgcggc gaccgagttg ctcttgcccg gcgtcaatac gggataatac

     2761 cgcgccacat agcagaactt taaaagtgct catcattgga aaacgttctt cggggcgaaa

     2821 actctcaagg atcttaccgc tgttgagatc cagttcgatg taacccactc gtgcacccaa

     2881 ctgatcttca gcatctttta ctttcaccag cgtttctggg tgagcaaaaa caggaaggca

     2941 aaatgccgca aaaaagggaa taagggcgac acggaaatgt tgaatactca tactcttcct

     3001 ttttcaatat tattgaagca tttatcaggg ttattgtctc atgagcggat acatatttga

     3061 atgtatttag aaaaataaac aaataggggt tccgcgcaca tttccccgaa aagtgccacc

     3121 tgacgtctaa gaaaccatta ttatcatgac attaacctat aaaaataggc gtatcacgag

     3181 gccctttcgt cttcaagaat taattcggtc gaaaaaagaa aaggagaggg ccaagaggga

     3241 gggcattggt gactattgag cacgtgagta tacgtgatta agcacacaaa ggcagcttgg

     3301 agtatgtctg ttattaattt cacaggtagt tctggtccat tggtgaaagt ttgcggcttg

     3361 cagagcacag aggccgcaga atgtgctcta gactcgacag aagatgatat tgaaggagca

     3421 ctttttgggc ttggctggag ctagtggagg tcaacaatga atgcctattt tggtttagtc

     3481 gtccaggcgg tgagcacaaa atttgtgtcg tttgacaaga tggttcattt aggcaactgg

     3541 tcagatcagc cccacttgta gcagtagcgg cggcgctcga agtgtgactc ttattagcag

     3601 acaggaacga ggacattatt atcatctgct gcttggtgca cgataacttg gtgcgtttgt

     3661 caagcaaggt aagtgaacga cccggtcata ccttcttaag ttcgcccttc ctccctttat

     3721 ttcagattca atctgactta cctattctac ccaagcaaag cttcgattag gaagtaacca

     3781 tgaaaaagcc tgaactcacc gcgacgtctg tcgagaagtt tctgatcgaa aagttcgaca

     3841 gcgtctccga cctgatgcag ctctcggagg gcgaagaatc tcgtgctttc agcttcgatg

     3901 taggagggcg tggatatgtc ctgcgggtaa atagctgcgc cgatggtttc tacaaagatc

     3961 gttatgttta tcggcacttt gcatcggccg cgctcccgat tccggaagtg cttgacattg

     4021 gggagtttag cgagagcctg acctattgca tctcccgccg tgcacagggt gtcacgttgc

     4081 aagacctgcc tgaaaccgaa ctgcccgctg ttctacaacc ggtcgcggag gctatggatg

     4141 cgatcgctgc ggccgatctt agccagacga gcgggttcgg cccattcgga ccgcaaggaa

     4201 tcggtcaata cactacatgg cgtgatttca tatgcgcgat tgctgatccc catgtgtatc

     4261 actggcaaac tgtgatggac gacaccgtca gtgcgtccgt cgcgcaggct ctcgatgagc

     4321 tgatgctttg ggccgaggac tgccccgaag tccggcacct cgtgcacgcg gatttcggct

     4381 ccaacaatgt cctgacggac aatggccgca taacagcggt cattgactgg agcgaggcga

     4441 tgttcgggga ttcccaatac gaggtcgcca acatcttctt ctggaggccg tggttggctt

     4501 gtatggagca gcagacgcgc tacttcgagc ggaggcatcc ggagcttgca ggatcgccac

     4561 gactccgggc gtatatgctc cgcattggtc ttgaccaact ctatcagagc ttggttgacg

     4621 gcaatttcga tgatgcagct tgggcgcagg gtcgatgcga cgcaatcgtc cgatccggag

     4681 ccgggactgt cgggcgtaca caaatcgccc gcagaagcgc ggccgtctgg accgatggct

     4741 gtgtagaagt actcgccgat agtggaaacc gacgccccag cactcgtccg agggcaaaga

     4801 aatagtccgt cgacctgcag atcgttcaaa catttggcaa taaagtttct taagattgaa

     4861 tcctgttgcc ggtcttgcga tgattatcat ataatttctg ttgaattacg ttaagcatgt

     4921 aataattaac atgtaatgca tagtaccgag aaactagtgg atctaaacat aaaatctgta

     4981 aaataacaag atgtaaagat aatgctaaat catttggctt tttgattgat tgtacaggaa

     5041 aatatacatc gcagggggtt gacttttacc atttcaccgc aatggaatca aacttgttga

     5101 agagaatgtt cacaggcgca tacgctacaa tgacccgatt cttgctagcc ttttctcggt

     5161 cttgcaaaca accgccgcgg ccggtcgagg gacctaataa cttcgtatag catacattat

     5221 acgaagttat attaagggtt ccggatcgcg gccgctcgac ctgcagccaa gctagcttgg

     5281 ctggacgtaa actcctcttc agacctaata acttcgtata gcatacatta tacgaagtta

     5341 tattaagggt tattgaatat gatcggaatt ggtcgatcag gtattgctgt tatctgatga

     5401 gtatacgttg tcctggccac ggcagaagca cgcttatcgc tccaatttcc cacaacatta

     5461 gtcaactccg ttaggccctt cattgaaaga aatgaggtca tcaaatgtct tccaatgtga

     5521 gattttgggc cattttttat agcaaagatt gaataaggcg catttttctt caaagcttgc

     5581 aaattaaagc cttcgagcgt cccaaaacct tctcaagcaa ggttttcagt ataatgttac

     5641 atgcgtacac gcgctatatt ttgttttcta tcgcgtatta aatgtataat tgcgggactc

     5701 taatcataaa aacccatctc ataaataacg tcatgcattg cagatgagct gtatctggaa

     5761 gaggtaaacc cgaaacgcgt tttattcttg ttgacatgga gctattaaat cactagaagg

     5821 cactctttgc tgcttggaca aatgaacgta tcttatcgag atcctgaaca ccatttgtct

     5881 caactccgga gctgacatcg acaccaacga tcttatatcc agattcgtca agctgtttga

     5941 tgatttcagt aacgttaagt ggatctcggt gacgggcagg accggacggg gc

//

 

Search name

pBARGPE1-Hygro,Plasmid pBARGPE1-Hygro,pBARGPE1-Hygro vector

No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart