pBARGPE1- mCherry

$216.00

  • Model: PVT5308
  • 50 Units in Stock
Ask a question


Add to Cart:

pBARGPE1-mCherry

PVT5308      2ug
 

pBARGPE1-mCherry Information

Use:Filamentous fungal plasmid

Promoter: gpdA, TrpC

Replicon: pUC ori

Terminator: trpC

Plasmid classification: other host shuttle vectors; filamentous fungi expressing plasmids.

Plasmid size: 6229bp

Plasmid label: mono red fluorescent protein mCherry

Prokaryotic resistance: ampicillin Ampicillin

Screening markers: LP Bar

Cloned strain: DH5 alpha

Culture conditions: 37 centigrade, aerobic, LB

Expression host: filamentous fungi

Induction mode: no induction

5'sequencing primers: Based on full sequence design

3'sequencing primers: Based on full sequence design

 

pBARGPE1-mCherry Description

PBARGPE1-mCherry is a filamentous fungus - Escherichia coli shuttle expression vector, which can use gpdA promoter to activate the expression of foreign gene, and can be transformed into filamentous fungi to be screened by gpdA.

pBARGPE1-mCherry

 

pBARGPE1-mCherry Sequence

LOCUS       Exported                6229 bp ds-DNA     circular SYN 30-AUG-2016

DEFINITION  synthetic circular DNA

ACCESSION   .

VERSION     .

KEYWORDS    pBARGPE1-mCherry

SOURCE      synthetic DNA construct

  ORGANISM  synthetic DNA construct

REFERENCE   1  (bases 1 to 6229)

  AUTHORS   .

  TITLE     Direct Submission

  JOURNAL   Exported Tuesday, August 30, 2016 from SnapGene Viewer 3.1.4

FEATURES             Location/Qualifiers

     source          1..6229

                     /organism="synthetic DNA construct"

                     /mol_type="other DNA"

     misc_feature    28..258

                     /note="trpC terminator"

     protein_bind    complement(652..685)

                     /bound_moiety="Cre recombinase"

                     /note="loxP"

                     /note="Cre-mediated recombination occurs in the 8-bp core 

                     sequence (GCATACAT)."

     protein_bind    complement(763..796)

                     /bound_moiety="Cre recombinase"

                     /note="loxP"

                     /note="Cre-mediated recombination occurs in the 8-bp core 

                     sequence (GCATACAT)."

     CDS             complement(1188..1739)

                     /codon_start=1

                     /gene="Streptomyces hygroscopicus bar"

                     /product="phosphinothricin acetyltransferase"

                     /note="BlpR"

                     /note="confers resistance to bialophos or phosphinothricin"

                     /translation="MSPERRPADIRRATEADMPAVCTIVNHYIETSTVNFRTEPQEPQE

                     WTDDLVRLRERYPWLVAEVDGEVAGIAYAGPWKARNAYDWTAESTVYVSPRHQRTGLGS

                     TLYTHLLKSLEAQGFKSVVAVIGLPNDPSVRMHEALGYAPRGMLRAAGFKHGNWHDVGF

                     WQLDFSLPVPPRPVLPVTEI"

     misc_feature    complement(1740..2125)

                     /note="TrpC Promotor"

     promoter        complement(2216..2317)

                     /gene="S. cerevisiae TRP1"

                     /note="TRP1 promoter"

     promoter        2423..2527

                     /gene="bla"

                     /note="AmpR promoter"

     CDS             2528..3388

                     /codon_start=1

                     /gene="bla"

                     /product="beta-lactamase"

                     /note="AmpR"

                     /note="confers resistance to ampicillin, carbenicillin, and

                     related antibiotics"

                     /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI

                     ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVEYS

                     PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW

                     EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA

                     LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS

                     LIKHW"

     rep_origin      3559..4147

                     /direction=RIGHT

                     /note="ori"

                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 

                     replication"

     misc_feature    4333..4473

                     /note="bom"

                     /note="basis of mobility region from pBR322"

     misc_feature    4688..5372

                     /note="gpdA Promoter"

     primer_bind     complement(5422..5438)

                     /note="KS primer"

                     /note="common sequencing primer, one of multiple similar 

                     variants"

     CDS             5474..6184

                     /codon_start=1

                     /product="monomeric derivative of DsRed fluorescent protein

                     (Shaner et al., 2004)"

                     /note="mCherry"

                     /note="mammalian codon-optimized"

                     /translation="MVSKGEEDNMAIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEG

                     TQTAKLKVTKGGPLPFAWDILSPQFMYGSKAYVKHPADIPDYLKLSFPEGFKWERVMNF

                     EDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASSERMYPEDGALK

                     GEIKQRLKLKDGGHYDAEVKTTYKAKKPVQLPGAYNVNIKLDITSHNEDYTIVEQYERA

                     EGRHSTGGMDELYK"

     primer_bind     complement(6196..6212)

                     /note="KS primer"

                     /note="common sequencing primer, one of multiple similar 

                     variants"

ORIGIN

        1 gccccgtccg gtcctgcccg tcaccgagat ccacttaacg ttactgaaat catcaaacag

       61 cttgacgaat ctggatataa gatcgttggt gtcgatgtca gctccggagt tgagacaaat

      121 ggtgttcagg atctcgataa gatacgttca tttgtccaag cagcaaagag tgccttctag

      181 tgatttaata gctccatgtc aacaagaata aaacgcgttt cgggtttacc tcttccagat

      241 acagctcatc tgcaatgcat gacgttattt atgagatggg tttttatgat tagagtcccg

      301 caattataca tttaatacgc gatagaaaac aaaatatagc gcgtgtacgc atgtaacatt

      361 atactgaaaa ccttgcttga gaaggttttg ggacgctcga aggctttaat ttgcaagctt

      421 tgaagaaaaa tgcgccttat tcaatctttg ctataaaaaa tggcccaaaa tctcacattg

      481 gaagacattt gatgacctca tttctttcaa tgaagggcct aacggagttg actaatgttg

      541 tgggaaattg gagcgataag cgtgcttctg ccgtggccag gacaacgtat actcatcaga

      601 taacagcaat acctgatcga ccaattccga tcatattcaa taacccttaa tataacttcg

      661 tataatgtat gctatacgaa gttattaggt ctgaagagga gtttacgtcc agccaagcta

      721 gcttggctgc aggtcgagcg gccgcgatcc ggaaccctta atataacttc gtataatgta

      781 tgctatacga agttattagg tccctcgacc ggccgcggcg gttgtttgca agaccgagaa

      841 aaggctagca agaatcgggt cattgtagcg tatgcgcctg tgaacattct cttcaacaag

      901 tttgattcca ttgcggtgaa atggtaaaag tcaaccccct gcgatgtata ttttcctgta

      961 caatcaatca aaaagccaaa tgatttagca ttatctttac atcttgttat tttacagatt

     1021 ttatgtttag atccactagt ttctcggtac tatgcattac atgttaatta ttacatgctt

     1081 aacgtaattc aacagaaatt atatgataat catcgcaaga ccggcaacag gattcaatct

     1141 taagaaactt tattgccaaa tgtttgaacg atctgcaggt cgacggatca gatctcggtg

     1201 acgggcagga ccggacgggg cggtaccggc aggctgaagt ccagctgcca gaaacccacg

     1261 tcatgccagt tcccgtgctt gaagccggcc gcccgcagca tgccgcgggg ggcatatccg

     1321 agcgcctcgt gcatgcgcac gctcgggtcg ttgggcagcc cgatgacagc gaccacgctc

     1381 ttgaagccct gtgcctccag ggacttcagc aggtgggtgt agagcgtgga gcccagtccc

     1441 gtccgctggt ggcgggggga gacgtacacg gtcgactcgg ccgtccagtc gtaggcgttg

     1501 cgtgccttcc aggggcccgc gtaggcgatg ccggcgacct cgccgtccac ctcggcgacg

     1561 agccagggat agcgctcccg cagacggacg aggtcgtccg tccactcctg cggttcctgc

     1621 ggctcggtac ggaagttgac cgtgcttgtc tcgatgtagt ggttgacgat ggtgcagacc

     1681 gccggcatgt ccgcctcggt ggcacggcgg atgtcggccg ggcgtcgttc tgggctcatg

     1741 gttacttcct aatcgaagct ttgcttgggt agaataggta agtcagattg aatctgaaat

     1801 aaagggagga agggcgaact taagaaggta tgaccgggtc gttcacttac cttgcttgac

     1861 aaacgcacca agttatcgtg caccaagcag cagatgataa taatgtcctc gttcctgtct

     1921 gctaataaga gtcacacttc gagcgccgcc gctactgcta caagtggggc tgatctgacc

     1981 agttgcctaa atgaaccatc ttgtcaaacg acacaaattt tgtgctcacc gcctggacga

     2041 ctaaaccaaa ataggcattc attgttgacc tccactagct ccagccaagc ccaaaaagtg

     2101 ctccttcaat atcatcttct gtcgagtcta gagcacattc tgcggcctct gtgctctgca

     2161 agccgcaaac tttcaccaat ggaccagaac tacctgtgaa attaataaca gacatactcc

     2221 aagctgcctt tgtgtgctta atcacgtata ctcacgtgct caatagtcac caatgccctc

     2281 cctcttggcc ctctcctttt cttttttcga ccgaattaat tcttgaagac gaaagggcct

     2341 cgtgatacgc ctatttttat aggttaatgt catgataata atggtttctt agacgtcagg

     2401 tggcactttt cggggaaatg tgcgcggaac ccctatttgt ttatttttct aaatacattc

     2461 aaatatgtat ccgctcatga gacaataacc ctgataaatg cttcaataat attgaaaaag

     2521 gaagagtatg agtattcaac atttccgtgt cgcccttatt cccttttttg cggcattttg

     2581 ccttcctgtt tttgctcacc cagaaacgct ggtgaaagta aaagatgctg aagatcagtt

     2641 gggtgcacga gtgggttaca tcgaactgga tctcaacagc ggtaagatcc ttgagagttt

     2701 tcgccccgaa gaacgttttc caatgatgag cacttttaaa gttctgctat gtggcgcggt

     2761 attatcccgt attgacgccg ggcaagagca actcggtcgc cgcatacact attctcagaa

     2821 tgacttggtt gagtactcac cagtcacaga aaagcatctt acggatggca tgacagtaag

     2881 agaattatgc agtgctgcca taaccatgag tgataacact gcggccaact tacttctgac

     2941 aacgatcgga ggaccgaagg agctaaccgc ttttttgcac aacatggggg atcatgtaac

     3001 tcgccttgat cgttgggaac cggagctgaa tgaagccata ccaaacgacg agcgtgacac

     3061 cacgatgcct gtagcaatgg caacaacgtt gcgcaaacta ttaactggcg aactacttac

     3121 tctagcttcc cggcaacaat taatagactg gatggaggcg gataaagttg caggaccact

     3181 tctgcgctcg gcccttccgg ctggctggtt tattgctgat aaatctggag ccggtgagcg

     3241 tgggtctcgc ggtatcattg cagcactggg gccagatggt aagccctccc gtatcgtagt

     3301 tatctacacg acggggagtc aggcaactat ggatgaacga aatagacaga tcgctgagat

     3361 aggtgcctca ctgattaagc attggtaact gtcagaccaa gtttactcat atatacttta

     3421 gattgattta aaacttcatt tttaatttaa aaggatctag gtgaagatcc tttttgataa

     3481 tctcatgacc aaaatccctt aacgtgagtt ttcgttccac tgagcgtcag accccgtaga

     3541 aaagatcaaa ggatcttctt gagatccttt ttttctgcgc gtaatctgct gcttgcaaac

     3601 aaaaaaacca ccgctaccag cggtggtttg tttgccggat caagagctac caactctttt

     3661 tccgaaggta actggcttca gcagagcgca gataccaaat actgttcttc tagtgtagcc

     3721 gtagttaggc caccacttca agaactctgt agcaccgcct acatacctcg ctctgctaat

     3781 cctgttacca gtggctgctg ccagtggcga taagtcgtgt cttaccgggt tggactcaag

     3841 acgatagtta ccggataagg cgcagcggtc gggctgaacg gggggttcgt gcacacagcc

     3901 cagcttggag cgaacgacct acaccgaact gagataccta cagcgtgagc tatgagaaag

     3961 cgccacgctt cccgaaggga gaaaggcgga caggtatccg gtaagcggca gggtcggaac

     4021 aggagagcgc acgagggagc ttccaggggg aaacgcctgg tatctttata gtcctgtcgg

     4081 gtttcgccac ctctgacttg agcgtcgatt tttgtgatgc tcgtcagggg ggcggagcct

     4141 atggaaaaac gccagcaacg cggccttttt acggttcctg gccttttgct ggccttttgc

     4201 tcacatgttc tttcctgcgt tatcccctga ttctgtggat aaccgtatta ccgcctttga

     4261 gtgagctgat accgctcgcc gcagccgaac gaccgagcgc agcgagtcag tgagcgagga

     4321 agcggaagag cgcctgatgc ggtattttct ccttacgcat ctgtgcggta tttcacaccg

     4381 catatggtgc actctcagta caatctgctc tgatgccgca tagttaagcc agtatacact

     4441 ccgctatcgc tacgtgactg ggtcatggct gcgccccgac acccgccaac acccgctgac

     4501 gcgccctgac gggcttgtct gctcccggca tccgcttaca gacaagctgt gaccgtctcc

     4561 gggagctgca tgtgtcagag gttttcaccg tcatcaccga aacgcgcgag gcagagatct

     4621 ctgtggaatg tgtgtcagtt agggtgtgga aagtccccag gctccccagc aggcagaagt

     4681 atgcaaagca tgcggagaga cggacggacg cagagagaag ggctgagtaa taagcgccac

     4741 tgcgccagac agctctggcg gctctgaggt gcagtggatg attattaatc cgggaccggc

     4801 cgcccctccg ccccgaagtg gaaaggctgg tgtgcccctc gttgaccaag aatctattgc

     4861 atcatcggag aatatggagc ttcatcgaat caccggcagt aagcgaagga gaatgtgaag

     4921 ccaggggtgt atagccgtcg gcgaaatagc atgccattaa cctaggtaca gaagtccaat

     4981 tgcttccgat ctggtaaaag attcacgaga tagtaccttc tccgaagtag gtagagcgag

     5041 tacccggcgc gtaagctccc taattggccc atccggcatc tgtagggcgt ccaaatatcg

     5101 tgcctctcct gctttgcccg gtgtatgaaa ccggaaaggc cgctcaggag ctggccagcg

     5161 gcgcagaccg ggaacacaag ctggcagtcg acccatccgg tgctctgcac tcgacctgct

     5221 gaggtccctc agtccctggt aggcagcttt gccccgtctg tccgcccggt gtgtcggcgg

     5281 ggttgacaag gtcgttgcgt cagtccaaca tttgttgcca tattttcctg ctctccccac

     5341 cagctgctct tttcttttct ctttcttttc ccatcttcag tatattcatc ttcccatcca

     5401 agaaccttta atcaagctta tcgataccgt cgacctcgac tctagaggat cccccgggct

     5461 gcaggaattc gatatggtga gcaagggcga ggaggataac atggccatca tcaaggagtt

     5521 catgcgcttc aaggtgcaca tggagggctc cgtgaacggc cacgagttcg agatcgaggg

     5581 cgagggcgag ggccgcccct acgagggcac ccagaccgcc aagctgaagg tgaccaaggg

     5641 tggccccctg cccttcgcct gggacatcct gtcccctcag ttcatgtacg gctccaaggc

     5701 ctacgtgaag caccccgccg acatccccga ctacttgaag ctgtccttcc ccgagggctt

     5761 caagtgggag cgcgtgatga acttcgagga cggcggcgtg gtgaccgtga cccaggactc

     5821 ctccctgcag gacggcgagt tcatctacaa ggtgaagctg cgcggcacca acttcccctc

     5881 cgacggcccc gtaatgcaga agaagaccat gggctgggag gcctcctccg agcggatgta

     5941 ccccgaggac ggcgccctga agggcgagat caagcagagg ctgaagctga aggacggcgg

     6001 ccactacgac gctgaggtca agaccaccta caaggccaag aagcccgtgc agctgcccgg

     6061 cgcctacaac gtcaacatca agttggacat cacctcccac aacgaggact acaccatcgt

     6121 ggaacagtac gaacgcgccg agggccgcca ctccaccggc ggcatggacg agctgtacaa

     6181 gtaaatcaag cttatcgata ccgtcgacct cgaggggggg cccggtacc

//

Caution:
Product is for research use only!

 

Search name

pBARGPE1-mCherry,Plasmid pBARGPE1-mCherry,pBARGPE1-mCherry vector

No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart