pBARGPE1-PyrG

$280.00

  • Model: PVT12253
  • 20 Units in Stock
Ask a question


Add to Cart:

pBARGPE1-PyrG

PVT12253    2ug
 

 

pBARGPE1-PyrG Search name

pBARGPE1-PyrG,pBARGPE1-PyrG vector,pBARGPE1-PyrG plasmid,pBARGPE1-PyrG map

 

 

pBARGPE1-PyrG Information

Prokaryotic resistance: amp

Eukaryotic resistance: pyrG

Clone strain: DH5 α

Culture condition: 37 ℃

Plasmid host: filamentous fungi

Purpose of plasmid: protein expression

Fragment type: gene CDS

Fragment species: empty vector

Prokaryotic resistance: ampicillin

 

pBARGPE1-PyrG Description

pBARGPE1-PyrG is a fungal expression vector.
 

pBARGPE1-PyrG Sequence

 

LOCUS       Exported                5800 bp ds-DNA     circular SYN 08-JUL-2018

DEFINITION  synthetic circular DNA

ACCESSION   .

VERSION     .

KEYWORDS    pBARGPE1-Pyrg

SOURCE      synthetic DNA construct

  ORGANISM  synthetic DNA construct

REFERENCE   1  (bases 1 to 5800)

  AUTHORS   .

  TITLE     Direct Submission

FEATURES             Location/Qualifiers

     source          1..5800

                     /organism="synthetic DNA construct"

                     /mol_type="other DNA"

     misc_feature    16..72

                     /note="MCS"

     primer_bind     18..34

                     /note="KS primer"

                     /note="common sequencing primer, one of multiple similar 

                     variants"

     misc_feature    complement(147..831)

                     /note="gpda Promoter"

     misc_feature    1046..1186

                     /note="bom"

                     /note="basis of mobility region from pBR322"

     rep_origin      complement(1372..1960)

                     /direction=LEFT

                     /note="ori"

                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 

                     replication"

     misc_feature    complement(2131..2991)

                     /note="AmpR"

     promoter        complement(2992..3096)

                     /gene="bla"

                     /note="AmpR promoter"

     promoter        3202..3303

                     /gene="S. cerevisiae TRP1"

                     /note="TRP1 promoter"

     misc_feature    3394..3779

                     /note="TrpC Promotor"

     CDS             3780..4613

                     /codon_start=1

                     /note="pyrg"

                     /translation="MSSKSQLTYSARASKHPNALVKKLFEIAEAKKTNVTVSADVTTTK

                     ELLDLADRLGPHIAVIKTHIDILSDFSEETTTGLKALAEKHNFLIFEDRKFIDIGNTVQ

                     KQYHGGVLRISEWAHIINCAILPGEGIVEALAQTAAAADFPYGSERGLLILAEMTSKGS

                     LATGQYTTSSVDYARKYKKFVMGFVSTRSLGEVESAVSERSEEEDFVVFTTGVNLSSKG

                     DKLGQQYQTPESAIGRGADFIIAGRGIYAAPDPVEAVQRYQKEGWEAYQARVAGQ"

     protein_bind    5005..5038

                     /bound_moiety="Cre recombinase"

                     /note="loxP"

                     /note="Cre-mediated recombination occurs in the 8-bp core 

                     sequence (GCATACAT)."

     protein_bind    5116..5149

                     /bound_moiety="Cre recombinase"

                     /note="loxP"

                     /note="Cre-mediated recombination occurs in the 8-bp core 

                     sequence (GCATACAT)."

     misc_feature    5543..5773

                     /note="trpC terminator"

ORIGIN

        1 ggtaccgggc cccccctcga ggtcgacggt atcgataagc ttgatatcga attcctgcag

       61 cccgggggat cctctagagt cgaggtcgac ggtatcgata agcttgatta aaggttcttg

      121 gatgggaaga tgaatatact gaagatggga aaagaaagag aaaagaaaag agcagctggt

      181 ggggagagca ggaaaatatg gcaacaaatg ttggactgac gcaacgacct tgtcaacccc

      241 gccgacacac cgggcggaca gacggggcaa agctgcctac cagggactga gggacctcag

      301 caggtcgagt gcagagcacc ggatgggtcg actgccagct tgtgttcccg gtctgcgccg

      361 ctggccagct cctgagcggc ctttccggtt tcatacaccg ggcaaagcag gagaggcacg

      421 atatttggac gccctacaga tgccggatgg gccaattagg gagcttacgc gccgggtact

      481 cgctctacct acttcggaga aggtactatc tcgtgaatct tttaccagat cggaagcaat

      541 tggacttctg tacctaggtt aatggcatgc tatttcgccg acggctatac acccctggct

      601 tcacattctc cttcgcttac tgccggtgat tcgatgaagc tccatattct ccgatgatgc

      661 aatagattct tggtcaacga ggggcacacc agcctttcca cttcggggcg gaggggcggc

      721 cggtcccgga ttaataatca tccactgcac ctcagagccg ccagagctgt ctggcgcagt

      781 ggcgcttatt actcagccct tctctctgcg tccgtccgtc tctccgcatg ctttgcatac

      841 ttctgcctgc tggggagcct ggggactttc cacaccctaa ctgacacaca ttccacagag

      901 atctctgcct cgcgcgtttc ggtgatgacg gtgaaaacct ctgacacatg cagctcccgg

      961 agacggtcac agcttgtctg taagcggatg ccgggagcag acaagcccgt cagggcgcgt

     1021 cagcgggtgt tggcgggtgt cggggcgcag ccatgaccca gtcacgtagc gatagcggag

     1081 tgtatactgg cttaactatg cggcatcaga gcagattgta ctgagagtgc accatatgcg

     1141 gtgtgaaata ccgcacagat gcgtaaggag aaaataccgc atcaggcgct cttccgcttc

     1201 ctcgctcact gactcgctgc gctcggtcgt tcggctgcgg cgagcggtat cagctcactc

     1261 aaaggcggta atacggttat ccacagaatc aggggataac gcaggaaaga acatgtgagc

     1321 aaaaggccag caaaaggcca ggaaccgtaa aaaggccgcg ttgctggcgt ttttccatag

     1381 gctccgcccc cctgacgagc atcacaaaaa tcgacgctca agtcagaggt ggcgaaaccc

     1441 gacaggacta taaagatacc aggcgtttcc ccctggaagc tccctcgtgc gctctcctgt

     1501 tccgaccctg ccgcttaccg gatacctgtc cgcctttctc ccttcgggaa gcgtggcgct

     1561 ttctcatagc tcacgctgta ggtatctcag ttcggtgtag gtcgttcgct ccaagctggg

     1621 ctgtgtgcac gaaccccccg ttcagcccga ccgctgcgcc ttatccggta actatcgtct

     1681 tgagtccaac ccggtaagac acgacttatc gccactggca gcagccactg gtaacaggat

     1741 tagcagagcg aggtatgtag gcggtgctac agagttcttg aagtggtggc ctaactacgg

     1801 ctacactaga agaacagtat ttggtatctg cgctctgctg aagccagtta ccttcggaaa

     1861 aagagttggt agctcttgat ccggcaaaca aaccaccgct ggtagcggtg gtttttttgt

     1921 ttgcaagcag cagattacgc gcagaaaaaa aggatctcaa gaagatcctt tgatcttttc

     1981 tacggggtct gacgctcagt ggaacgaaaa ctcacgttaa gggattttgg tcatgagatt

     2041 atcaaaaagg atcttcacct agatcctttt aaattaaaaa tgaagtttta aatcaatcta

     2101 aagtatatat gagtaaactt ggtctgacag ttaccaatgc ttaatcagtg aggcacctat

     2161 ctcagcgatc tgtctatttc gttcatccat agttgcctga ctccccgtcg tgtagataac

     2221 tacgatacgg gagggcttac catctggccc cagtgctgca atgataccgc gagacccacg

     2281 ctcaccggct ccagatttat cagcaataaa ccagccagcc ggaagggccg agcgcagaag

     2341 tggtcctgca actttatccg cctccatcca gtctattaat tgttgccggg aagctagagt

     2401 aagtagttcg ccagttaata gtttgcgcaa cgttgttgcc attgctacag gcatcgtggt

     2461 gtcacgctcg tcgtttggta tggcttcatt cagctccggt tcccaacgat caaggcgagt

     2521 tacatgatcc cccatgttgt gcaaaaaagc ggttagctcc ttcggtcctc cgatcgttgt

     2581 cagaagtaag ttggccgcag tgttatcact catggttatg gcagcactgc ataattctct

     2641 tactgtcatg ccatccgtaa gatgcttttc tgtgactggt gagtactcaa ccaagtcatt

     2701 ctgagaatag tgtatgcggc gaccgagttg ctcttgcccg gcgtcaatac gggataatac

     2761 cgcgccacat agcagaactt taaaagtgct catcattgga aaacgttctt cggggcgaaa

     2821 actctcaagg atcttaccgc tgttgagatc cagttcgatg taacccactc gtgcacccaa

     2881 ctgatcttca gcatctttta ctttcaccag cgtttctggg tgagcaaaaa caggaaggca

     2941 aaatgccgca aaaaagggaa taagggcgac acggaaatgt tgaatactca tactcttcct

     3001 ttttcaatat tattgaagca tttatcaggg ttattgtctc atgagcggat acatatttga

     3061 atgtatttag aaaaataaac aaataggggt tccgcgcaca tttccccgaa aagtgccacc

     3121 tgacgtctaa gaaaccatta ttatcatgac attaacctat aaaaataggc gtatcacgag

     3181 gccctttcgt cttcaagaat taattcggtc gaaaaaagaa aaggagaggg ccaagaggga

     3241 gggcattggt gactattgag cacgtgagta tacgtgatta agcacacaaa ggcagcttgg

     3301 agtatgtctg ttattaattt cacaggtagt tctggtccat tggtgaaagt ttgcggcttg

     3361 cagagcacag aggccgcaga atgtgctcta gactcgacag aagatgatat tgaaggagca

     3421 ctttttgggc ttggctggag ctagtggagg tcaacaatga atgcctattt tggtttagtc

     3481 gtccaggcgg tgagcacaaa atttgtgtcg tttgacaaga tggttcattt aggcaactgg

     3541 tcagatcagc cccacttgta gcagtagcgg cggcgctcga agtgtgactc ttattagcag

     3601 acaggaacga ggacattatt atcatctgct gcttggtgca cgataacttg gtgcgtttgt

     3661 caagcaaggt aagtgaacga cccggtcata ccttcttaag ttcgcccttc ctccctttat

     3721 ttcagattca atctgactta cctattctac ccaagcaaag cttcgattag gaagtaacca

     3781 tgtcgtccaa gtcgcaattg acctactccg cccgtgccag caagcacccc aatgcgctgg

     3841 tgaagaagct cttcgagatc gccgaggcga agaagaccaa cgtcaccgtg tccgccgatg

     3901 tcacgaccac caaggagctc cttgatctgg cggaccgcct cggccctcac atcgccgtga

     3961 tcaaaaccca catcgacatc ctctccgact tcagcgagga aaccaccacc ggcctgaaag

     4021 ccctcgccga gaagcacaac ttcctcatct tcgaagaccg caagttcatc gacatcggca

     4081 acaccgtcca gaagcagtac cacggcggtg tcctccgcat ctccgaatgg gcccacatca

     4141 tcaattgcgc catcctcccg ggcgagggca tcgtcgaagc cctcgcccag accgccgccg

     4201 ccgccgactt cccctacggc tcggagcgcg gcctgctcat cctcgcggag atgacctcga

     4261 agggctcgct tgcgacgggc cagtacacga cctcgtcggt ggactacgcg cgcaaataca

     4321 agaagtttgt gatgggcttc gtgtcgaccc ggtcgctggg cgaggtcgag tcggcggtgt

     4381 cggagcgatc agaggaggag gactttgtgg tgttcacgac gggagtgaat ctctcgtcga

     4441 agggggataa gttggggcag caataccaga cgcctgagtc ggcgattggg cgtggtgcgg

     4501 atttcattat tgcgggtcgg ggcatctatg cggctcctga tccggttgag gccgtgcagc

     4561 ggtaccagaa ggaggggtgg gaggcgtacc aggcgcgcgt ggcgggtcag tagtccgtcg

     4621 acctgcagat cgttcaaaca tttggcaata aagtttctta agattgaatc ctgttgccgg

     4681 tcttgcgatg attatcatat aatttctgtt gaattacgtt aagcatgtaa taattaacat

     4741 gtaatgcata gtaccgagaa actagtggat ctaaacataa aatctgtaaa ataacaagat

     4801 gtaaagataa tgctaaatca tttggctttt tgattgattg tacaggaaaa tatacatcgc

     4861 agggggttga cttttaccat ttcaccgcaa tggaatcaaa cttgttgaag agaatgttca

     4921 caggcgcata cgctacaatg acccgattct tgctagcctt ttctcggtct tgcaaacaac

     4981 cgccgcggcc ggtcgaggga cctaataact tcgtatagca tacattatac gaagttatat

     5041 taagggttcc ggatcgcggc cgctcgacct gcagccaagc tagcttggct ggacgtaaac

     5101 tcctcttcag acctaataac ttcgtatagc atacattata cgaagttata ttaagggtta

     5161 ttgaatatga tcggaattgg tcgatcaggt attgctgtta tctgatgagt atacgttgtc

     5221 ctggccacgg cagaagcacg cttatcgctc caatttccca caacattagt caactccgtt

     5281 aggcccttca ttgaaagaaa tgaggtcatc aaatgtcttc caatgtgaga ttttgggcca

     5341 ttttttatag caaagattga ataaggcgca tttttcttca aagcttgcaa attaaagcct

     5401 tcgagcgtcc caaaaccttc tcaagcaagg ttttcagtat aatgttacat gcgtacacgc

     5461 gctatatttt gttttctatc gcgtattaaa tgtataattg cgggactcta atcataaaaa

     5521 cccatctcat aaataacgtc atgcattgca gatgagctgt atctggaaga ggtaaacccg

     5581 aaacgcgttt tattcttgtt gacatggagc tattaaatca ctagaaggca ctctttgctg

     5641 cttggacaaa tgaacgtatc ttatcgagat cctgaacacc atttgtctca actccggagc

     5701 tgacatcgac accaacgatc ttatatccag attcgtcaag ctgtttgatg atttcagtaa

     5761 cgttaagtgg atctcggtga cgggcaggac cggacggggc

//

 

Caution:
Product is for research use only!

No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart