pBBR1MCS- 1 Plasmid

$216.00

  • Model: PVT5601
  • 50 Units in Stock
Ask a question


Add to Cart:

pBBR1MCS-1

Search name

pBBR1MCS-1,Plasmid pBBR1MCS-1,pBBR1MCS-1 vector

 

pBBR1MCS-1 Information

Promoter: Lac/lac, T3, T7, or clone promoter

Replicator: pBBR1 Rep, pBBR1 oriV

Plasmid classification: pBBR1MCS series plasmids

Plasmid size: 4707bp

Plasmid label: LacZ

Prokaryotic resistance: chloramphenicol Chloramphenicol

Cloned strain: DH5 alpha

Culture conditions: 37 centigrade, aerobic, LB

Host: a wide host

Culture conditions: Reference Literature

5'sequencing primers: M13R:CAGGAAACAGCTATGACC

3'sequencing primers: M13F:TGTAAAACGACGGCCAGT

Remarks: low copy plasmids

A brief introduction of plasmids

Use:pBBR1MCS Series plasmid

 

pBBR1MCS-1 Description

Broad host shuttle plasmid pBBR1MCS-1 is constructed by Kovach, has confirmed that [2] can replicate in many Gram-negative bacteria, including Acetobacter xylinum, Alcaligenes eutrophus, Bartonella, bacilliformis (Bordetella spp.), pertussis (Brucella spp.), Caulobacter of Brucella crescentus, Escherichia coli, Pseudomonas fluorescens, Paracoccous denitrificans (Pseudomonas fluorescens) Pseudomonas putida (P., putida), alfalfa Rhizobium (Rhizobium meliloti), R. leguminosarum by. Viciae, rhodobactersphaeroides (Rhodobacter sphaeroides), Salmonella typhimurium (Salmonella, typhimurium) of Vibrio cholerae (Vibrio cholerae) and Xanthomonas campestris.

[1] Kovach ME, et al. pBBR1MCS: a broad-host-range cloning vector. Biotechniques, 1994,16 (5):

[2] Kovach ME, Elzer PH, Hill DS, et al. Four new, al., and PH.

pBBR1MCS-1-plasmid

 

pBBR1MCS-1 Sequence

LOCUS       Exported                4707 bp ds-DNA     circular SYN 04-SEP-2016
DEFINITION  synthetic circular DNA
ACCESSION   .
VERSION     .
KEYWORDS    pBBR1MCS-1
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 4707)
  AUTHORS   .
  TITLE     Direct Submission
  JOURNAL   Exported Sunday, September 4, 2016 from SnapGene Viewer 3.1.4
             
FEATURES             Location/Qualifiers
     source          1..4707
                     /organism="synthetic DNA construct"
                     /mol_type="other DNA"
     rep_origin      1023..1792
                     /note="pBBR1 oriV"
                     /note="replication origin of the broad-host-range plasmid 
                     pBBR1 from Bordetella bronchiseptica; requires the pBBR1 
                     Rep protein for replication"
     CDS             1793..2455
                     /codon_start=1
                     /product="replication protein for the broad-host-range 
                     plasmid pBBR1 from Bordetella bronchiseptica"
                     /note="pBBR1 Rep"
                     /translation="MATQSREIGIQAKNKPGHWVQTERKAHEAWAGLIARKPTAAMLLH
                     HLVAQMGHQNAVVVSQKTLSKLIGRSLRTVQYAVKDLVAERWISVVKLNGPGTVSAYVV
                     NDRVAWGQPRDQLRLSVFSAAVVVDHDDQDESLLGHGDLRRIPTLYPGEQQLPTGPGEE
                     PPSQPGIPGMEPDLPALTETEEWERRGQQRLPMPDEPCFLDDGEPLEPPTRVTLPRR"
     CDS             complement(3013..3378)
                     /codon_start=1
                     /gene="lacZ fragment"
                     /product="LacZ-alpha fragment of beta-galactosidase"
                     /note="lacZ-alpha"
                     /translation="MTMITPSAQLTLTKGNKSWVPGPPSRSTVSISLISNSCSPGDPLV
                     LERPPPRWSSNSPYSESYYARSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAR
                     TDRPSQQLRSLNGEWKL"
     primer_bind     3162..3178
                     /note="M13 fwd"
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     promoter        3188..3206
                     /note="T7 promoter"
                     /note="promoter for bacteriophage T7 RNA polymerase"
     misc_feature    3215..3322
                     /note="MCS"
                     /note="pBluescript multiple cloning site"
     primer_bind     3239..3255
                     /note="SK primer"
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     primer_bind     complement(3289..3305)
                     /note="KS primer"
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     promoter        complement(3335..3353)
                     /note="T3 promoter"
                     /note="promoter for bacteriophage T3 RNA polymerase"
     primer_bind     complement(3374..3390)
                     /note="M13 rev"
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     protein_bind    3398..3414
                     /bound_moiety="lac repressor encoded by lacI"
                     /note="lac operator"
                     /note="The lac repressor binds to the lac operator to 
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     promoter        complement(3422..3452)
                     /note="lac promoter"
                     /note="promoter for the E. coli lac operon"
     protein_bind    3467..3488
                     /bound_moiety="E. coli catabolite activator protein"
                     /note="CAP binding site"
                     /note="CAP binding activates transcription in the presence 
                     of cAMP."
     CDS             complement(3545..4234)
                     /codon_start=1
                     /note="Chl"
                     /translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL
                     KTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDGELVIWDSVHPCYTVFHEQTETFSS
                     LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM
                     DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQFLCMRPIRKPPL
                     PARWPIH"
     promoter        complement(4235..4337)
                     /note="cat promoter"
                     /note="promoter of the E. coli cat gene encoding 
                     chloramphenicol acetyltransferase"
ORIGIN
        1 ctcgggccgt ctcttgggct tgatcggcct tcttgcgcat ctcacgcgct cctgcggcgg
       61 cctgtagggc aggctcatac ccctgccgaa ccgcttttgt cagccggtcg gccacggctt
      121 ccggcgtctc aacgcgcttt gagattccca gcttttcggc caatccctgc ggtgcatagg
      181 cgcgtggctc gaccgcttgc gggctgatgg tgacgtggcc cactggtggc cgctccaggg
      241 cctcgtagaa cgcctgaatg cgcgtgtgac gtgccttgct gccctcgatg ccccgttgca
      301 gccctagatc ggccacagcg gccgcaaacg tggtctggtc gcgggtcatc tgcgctttgt
      361 tgccgatgaa ctccttggcc gacagcctgc cgtcctgcgt cagcggcacc acgaacgcgg
      421 tcatgtgcgg gctggtttcg tcacggtgga tgctggccgt cacgatgcga tccgccccgt
      481 acttgtccgc cagccacttg tgcgccttct cgaagaacgc cgcctgctgt tcttggctgg
      541 ccgacttcca ccattccggg ctggccgtca tgacgtactc gaccgccaac acagcgtcct
    &n
No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart