LOCUS Exported 4768 bp ds-DNA circular SYN 24-JUN-2016
DEFINITION synthetic circular DNA
ACCESSION .
VERSION .
KEYWORDS pBBR1MCS-5
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 4768)
AUTHORS .
TITLE Direct Submission
JOURNAL Exported Saturday, September 10, 2016 from SnapGene Viewer 3.1.4
FEATURES Location/Qualifiers
source 1..4768
/organism="synthetic DNA construct"
/mol_type="other DNA"
rep_origin 1023..1792
/note="pBBR1 oriV"
/note="replication origin of the broad-host-range plasmid
pBBR1 from Bordetella bronchiseptica; requires the pBBR1
Rep protein for replication"
CDS 1793..2455
/codon_start=1
/product="replication protein for the broad-host-range
plasmid pBBR1 from Bordetella bronchiseptica"
/note="pBBR1 Rep"
/translation="MATQSREIGIQAKNKPGHWVQTERKAHEAWAGLIARKPTAAMLLH
HLVAQMGHQNAVVVSQKTLSKLIGRSLRTVQYAVKDLVAERWISVVKLNGPGTVSAYVV
NDRVAWGQPRDQLRLSVFSAAVVVDHDDQDESLLGHGDLRRIPTLYPGEQQLPTGPGEE
PPSQPGIPGMEPDLPALTETEEWERRGQQRLPMPDEPCFLDDGEPLEPPTRVTLPRR"
CDS complement(3013..3378)
/codon_start=1
/gene="lacZ fragment"
/product="LacZ-alpha fragment of beta-galactosidase"
/note="lacZ-alpha"
/translation="MTMITPSAQLTLTKGNKSWVPGPPSRSTVSISLISNSCSPGDPLV
LERPPPRWSSNSPYSESYYARSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAR
TDRPSQQLRSLNGEWKL"
primer_bind 3162..3178
/note="M13 fwd"
/note="common sequencing primer, one of multiple similar
variants"
promoter 3188..3206
/note="T7 promoter"
/note="promoter for bacteriophage T7 RNA polymerase"
misc_feature 3215..3322
/note="MCS"
/note="pBluescript multiple cloning site"
primer_bind 3239..3255
/note="SK primer"
/note="common sequencing primer, one of multiple similar
variants"
primer_bind complement(3289..3305)
/note="KS primer"
/note="common sequencing primer, one of multiple similar
variants"
promoter complement(3335..3353)
/note="T3 promoter"
/note="promoter for bacteriophage T3 RNA polymerase"
primer_bind complement(3374..3390)
/note="M13 rev"
/note="common sequencing primer, one of multiple similar
variants"
protein_bind 3398..3414
/bound_moiety="lac repressor encoded by lacI"
/note="lac operator"
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG)."
promoter complement(3422..3452)
/note="lac promoter"
/note="promoter for the E. coli lac operon"
protein_bind 3467..3488
/bound_moiety="E. coli catabolite activator protein"
/note="CAP binding site"
/note="CAP binding activates transcription in the presence
of cAMP."
promoter 3758..3786
/gene="intI1 (promoter lies within the coding sequence)"
/note="Pc promoter"
/note="class 1 integron promoter"
CDS 3975..4508
/codon_start=1
/gene="aacC1"
/product="gentamycin acetyltransferase"
/note="GmR"
/note="confers resistance to gentamycin"
/translation="MLRSSNDVTQQGSRPKTKLGGSSMGIIRTCRLGPDQVKSMRAALD
LFGREFGDVATYSQHQPDSDYLGNLLRSKTFIALAAFDQEAVVGALAAYVLPRFEQPRS
EIYIYDLAVSGEHRRQGIATALINLLKHEANALGAYVIYVQADYGDDPAVALYTKLGIR
EEVMHFDIDPSTAT"
ORIGIN
1 ctcgggccgt ctcttgggct tgatcggcct tcttgcgcat ctcacgcgct cctgcggcgg
61 cctgtagggc aggctcatac ccctgccgaa ccgcttttgt cagccggtcg gccacggctt
121 ccggcgtctc aacgcgcttt gagattccca gcttttcggc caatccctgc ggtgcatagg
181 cgcgtggctc gaccgcttgc gggctgatgg tgacgtggcc cactggtggc cgctccaggg
241 cctcgtagaa cgcctgaatg cgcgtgtgac gtgccttgct gccctcgatg ccccgttgca
301 gccctagatc ggccacagcg gccgcaaacg tggtctggtc gcgggtcatc tgcgctttgt
361 tgccgatgaa ctccttggcc gacagcctgc cgtcctgcgt cagcggcacc acgaacgcgg
421 tcatgtgcgg gctggtttcg tcacggtgga tgctggccgt cacgatgcga tccgccccgt
481 acttgtccgc cagccacttg tgcgccttct cgaagaacgc cgcctgctgt tcttggctgg
541 ccgacttcca ccattccggg ctggccgtca tgacgtactc gaccgccaac acagcgtcct
601 tgcgccgctt ctctggcagc aactcgcgca gtcggcccat cgcttcatcg gtgctgctgg
661 ccgcccagtg ctcgttctct ggcgtcctgc tggcgtcagc gttgggcgtc tcgcgctcgc
721 ggtaggcgtg cttgagactg gccgccacgt tgcccatttt cgccagcttc ttgcatcgca
781 tgatcgcgta tgccgccatg cctgcccctc ccttttggtg tccaaccggc tcgacggggg
841 cagcgcaagg cggtgcctcc ggcgggccac tcaatgcttg agtatactca ctagactttg
901 cttcgcaaag tcgtgaccgc ctacggcggc tgcggcgccc tacgggcttg ctctccgggc
961 ttcgccctgc gcggtcgctg cgctcccttg ccagcccgtg gatatgtgga cgatggccgc
1021 gagcggccac cggctggctc gcttcgctcg gcccgtggac aaccctgctg gacaagctga
1081 tggacaggct gcgcctgccc acgagcttga ccacagggat tgcccaccgg ctacccagcc
1141 ttcgaccaca tacccaccgg ctccaactgc gcggcctgcg gccttgcccc atcaattttt
1201 ttaattttct ctggggaaaa gcctccggcc tgcggcctgc gcgcttcgct tgccggttgg
1261 acaccaagtg gaaggcgggt caaggctcgc gcagcgaccg cgcagcggct tggccttgac
1321 gcgcctggaa cgacccaagc ctatgcgagt gggggcagtc gaaggcgaag cccgcccgcc
1381 tgccccccga gcctcacggc ggcgagtgcg ggggttccaa gggggcagcg ccaccttggg
1441 caaggccgaa ggccgcgcag tcgatcaaca agccccggag gggccacttt ttgccggagg
1501 gggagccgcg ccgaaggcgt gggggaaccc cgcaggggtg cccttctttg ggcaccaaag
1561 aactagatat agggcgaaat gcgaaagact taaaaatcaa caacttaaaa aaggggggta
1621 cgcaacagct cattgcggca ccccccgcaa tagctcattg cgtaggttaa agaaaatctg
1681 taattgactg ccacttttac gcaacgcata attgttgtcg cgctgccgaa aagttgcagc
1741 tgattgcgca tggtgccgca accgtgcggc accctaccgc atggagataa gcatggccac
1801 gcagtccaga gaaatcggca ttcaagccaa gaacaagccc ggtcactggg tgcaaacgga
1861 acgcaaagcg catgaggcgt gggccgggct tattgcgagg aaacccacgg cggcaatgct
1921 gctgcatcac ctcgtggcgc agatgggcca ccagaacgcc gtggtggtca gccagaagac
1981 actttccaag ctcatcggac gttctttgcg gacggtccaa tacgcagtca aggacttggt
2041 ggccgagcgc tggatctccg tcgtgaagct caacggcccc ggcaccgtgt cggcctacgt
2101 ggtcaatgac cgcgtggcgt ggggccagcc ccgcgaccag ttgcgcctgt cggtgttcag
2161 tgccgccgtg gtggttgatc acgacgacca ggacgaatcg ctgttggggc atggcgacct
2221 gcgccgcatc ccgaccctgt atccgggcga gcagcaacta ccgaccggcc ccggcgagga
2281 gccgcccagc cagcccggca ttccgggcat ggaaccagac ctgccagcct tgaccgaaac
2341 ggaggaatgg gaacggcgcg ggcagcagcg cctgccgatg cccgatgagc cgtgttttct
2401 ggacgatggc gagccgttgg agccgccgac acgggtcacg ctgccgcgcc ggtagcactt
2461 gggttgcgca gcaacccgta agtgcgctgt tccagactat cggctgtagc cgcctcgccg
2521 ccctatacct tgtctgcctc cccgcgttgc gtcgcggtgc atggagccgg gccacctcga
2581 cctgaatgga agccggcggc acctcgctaa cggattcacc gtttttatca ggctctggga
2641 ggcagaataa atgatcatat cgtcaattat tacctccacg gggagagcct gagcaaactg
2701 gcctcaggca tttgagaagc acacggtcac actgcttccg gtagtcaata aaccggtaaa
2761 ccagcaatag acataagcgg ctatttaacg accctgccct gaaccgacga ccgggtcgaa
2821 tttgctttcg aatttctgcc attcatccgc ttattatcac ttattcaggc gtagcaccag
2881 gcgtttaagg gcaccaataa ctgccttaaa aaaattacgc cccgccctgc cactcatcgc
2941 agtcggccta ttggttaaaa aatgagctga tttaacaaaa atttaacgcg aattttaaca
3001 aaatattaac gcttacaatt tccattcgcc attcaggctg cgcaactgtt gggaagggcg
3061 atcggtgcgg gcctcttcgc tattacgcca gctggcgaaa gggggatgtg ctgcaaggcg
3121 attaagttgg gtaacgccag ggttttccca gtcacgacgt tgtaaaacga cggccagtga
3181 gcgcgcgtaa tacgactcac tatagggcga attggagctc caccgcggtg gcggccgctc
3241 tagaactagt ggatcccccg ggctgcagga attcgatatc aagcttatcg ataccgtcga
3301 cctcgagggg gggcccggta cccagctttt gttcccttta gtgagggtta attgcgcgct
3361 tggcgtaatc atggtcatag ctgtttcctg tgtgaaattg ttatccgctc acaattccac
3421 acaacatacg agccggaagc ataaagtgta aagcctgggg tgcctaatga gtgagctaac
3481 tcacattaat tgcgttgcgc tcactgcccg ctttccagtc gggaaacctg tcgtgccagc
3541 tgcattaatg aatcggccaa cgcgcgggga gaggcggttt gcgtattggg cgcatgcata
3601 aaaactgttg taattcatta agcattctgc cgacatggaa gccatcacaa acggcatgat
3661 gaacctgaat cgccagcggc atcagcacct tgtcgccttg cgtataatat ttgcccatgg
3721 acgcacaccg tggaaacgga tgaaggcacg aacccagttg acataagcct gttcggttcg
3781 taaactgtaa tgcaagtagc gtatgcgctc acgcaactgg tccagaacct tgaccgaacg
3841 cagcggtggt aacggcgcag tggcggtttt catggcttgt tatgactgtt tttttgtaca
3901 gtctatgcct cgggcatcca agcagcaagc gcgttacgcc gtgggtcgat gtttgatgtt
3961 atggagcagc aacgatgtta cgcagcagca acgatgttac gcagcagggc agtcgcccta
4021 aaacaaagtt aggtggctca agtatgggca tcattcgcac atgtaggctc ggccctgacc
4081 aagtcaaatc catgcgggct gctcttgatc ttttcggtcg tgagttcgga gacgtagcca
4141 cctactccca acatcagccg gactccgatt acctcgggaa cttgctccgt agtaagacat
4201 tcatcgcgct tgctgccttc gaccaagaag cggttgttgg cgctctcgcg gcttacgttc
4261 tgcccaggtt tgagcagccg cgtagtgaga tctatatcta tgatctcgca gtctccggcg
4321 agcaccggag gcagggcatt gccaccgcgc tcatcaatct cctcaagcat gaggccaacg
4381 cgcttggtgc ttatgtgatc tacgtgcaag cagattacgg tgacgatccc gcagtggctc
4441 tctatacaaa gttgggcata cgggaagaag tgatgcactt tgatatcgac ccaagtaccg
4501 ccacctaaca attcgttcaa gccgagatcg gcttcccggc cgcggagttg ttcggtaaat
4561 tgtcacaacg ccgccaggtg gcacttttcg gggaaatgtg cgcgcccgcg ttcctgctgg
4621 cgctgggcct gtttctggcg ctggacttcc cgctgttccg tcagcagctt ttcgcccacg
4681 gccttgatga tcgcggcggc cttggcctgc atatcccgat tcaacggccc cagggcgtcc
4741 agaacgggct tcaggcgctc ccgaaggt
//
Caution:
1. This product is FOR RESEARCH USE ONLY!
2. The item is lyophilized form, Please take the powder plasmid by centrifugation at 5000rpm/min for 1min. Add 20μl ddH2O in to the tube of plasmid.
Search name
pBBR1MCS-5,Plasmid pBBR1MCS-5,pBBR1MCS-5 vector