pBBR1MCS2- pAMP- EGFP Plasmid

$216.00

  • Model: PVT5607
  • 50 Units in Stock
Ask a question


Add to Cart:

pBBR1MCS2-pAMP-EGFP Plasmid

PVT5607    2ug

 

pBBR1MCS2-pAmp-EGFP Information

Promoter: pAmp
Replicator: pBBR1 Rep, pBBR1 oriV
Plasmid classification: pBBR1MCS series plasmids
Plasmid size: 5996bp
Plasmid label: EGFP
Prokaryotic resistance: kanamycin Kanamycin
Cloned strain: DH5 alpha
Culture conditions: 37 centigrade, aerobic, LB
Expression host: Gram-negative bacteria
Culture conditions: Reference Literature
5'sequencing primers: M13R:CAGGAAACAGCTATGACC
3'sequencing primers: M13F:TGTAAAACGACGGCCAGT
Remarks: low copy plasmids
Use:pBBR7MCS Series plasmid

 

 

pBBR1MCS2-pAmp-EGFP Description

PBBR1MCS2-pAmp-EGFP is based on the construction of plasmid pBBR1MCS, the plasmid is constructed by Kovach, has been shown to replicate in many Gram-negative bacteria, including Acetobacter xylinum, Alcaligenes eutrophus, Bartonella bacilliformis (Bordetella spp.), pertussis, Blue Prand (Brucella spp.), Caulobacter crescentus, Paracoccous denitrificans, Escherichia coli, Pseudomonas fluorescens (Pseudomonas fluorescens), Pseudomonas putida (P. putida), r.meliloti (Rhizobium meliloti), R. leguminosarum by. Viciae, rhodobactersphaeroides (Rhodobacter sphaeroides), Salmonella typhimurium (Salmonella, typhimurium) of Vibrio cholerae (Vibrio cholerae) and Xanthomonas campestris.

pBBR1MCS2-pAmp-EGFP Reference

[1] Kovach ME, et al. pBBR1MCS: a broad-host-range cloning vector. Biotechniques, 1994,16(5): 800-802.

[2] Kovach ME, Elzer PH, Hill DS, et al. Four new derivatives of the broad-host-range cloning vector pBBR1MCS, carrying different antibiotic-resistance cassettes. Gene, 1995,166:175-176

pBBR1MCS2-pAmp-EGFP-polyclonal-site

 

pBBR1MCS2-pAmp-EGFP Sequence

LOCUS       Exported                5996 bp ds-DNA     circular SYN 23-JUL-2016

DEFINITION  synthetic circular DNA

ACCESSION   .

VERSION     .

KEYWORDS    pBBR1MCS2-pAmp-EGFP

SOURCE      synthetic DNA construct

  ORGANISM  synthetic DNA construct

REFERENCE   1  (bases 1 to 5996)

  AUTHORS   .

  TITLE     Direct Submission

  JOURNAL   Exported Saturday, September 10, 2016 from SnapGene Viewer 3.1.4

FEATURES             Location/Qualifiers

     source          1..5996

                     /organism="synthetic DNA construct"

                     /mol_type="other DNA"

     CDS             458..1252

                     /codon_start=1

                     /gene="aph(3')-II (or nptII)"

                     /product="aminoglycoside phosphotransferase from Tn5"

                     /note="NeoR/KanR"

                     /note="confers resistance to neomycin, kanamycin, and G418 

                     (Geneticin(R))"

                     /translation="MIEQDGLHAGSPAAWVERLFGYDWAQQTIGCSDAAVFRLSAQGRP

                     VLFVKTDLSGALNELQDEAARLSWLATTGVPCAAVLDVVTEAGRDWLLLGEVPGQDLLS

                     SHLAPAEKVSIMADAMRRLHTLDPATCPFDHQAKHRIERARTRMEAGLVDQDDLDEEHQ

                     GLAPAELFARLKARMPDGEDLVVTHGDACLPNIMVENGRFSGFIDCGRLGVADRYQDIA

                     LATRDIAEELGGEWADRFLVLYGIAAPDSQRIAFYRLLDEFF"

     protein_bind    1657..1678

                     /bound_moiety="E. coli catabolite activator protein"

                     /note="CAP binding site"

                     /note="CAP binding activates transcription in the presence 

                     of cAMP."

     promoter        1693..1723

                     /note="lac promoter"

                     /note="promoter for the E. coli lac operon"

     protein_bind    1731..1747

                     /bound_moiety="lac repressor encoded by lacI"

                     /note="lac operator"

                     /note="The lac repressor binds to the lac operator to 

                     inhibit transcription in E. coli. This inhibition can be 

                     relieved by adding lactose or 

                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."

     primer_bind     1755..1771

                     /note="M13 rev"

                     /note="common sequencing primer, one of multiple similar 

                     variants"

     promoter        1792..1810

                     /note="T3 promoter"

                     /note="promoter for bacteriophage T3 RNA polymerase"

     promoter        1850..1954

                     /gene="bla"

                     /note="AmpR promoter"

     CDS             1955..2671

                     /codon_start=1

                     /product="enhanced GFP"

                     /note="EGFP"

                     /note="mammalian codon-optimized"

                     /translation="MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTL

                     KFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDD

                     GNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIK

                     VNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLL

                     EFVTAAGITLGMDELYK"

     misc_feature    2672..2737

                     /note="MCS"

                     /note="multiple cloning site"

     promoter        complement(2791..2809)

                     /note="T7 promoter"

                     /note="promoter for bacteriophage T7 RNA polymerase"

     primer_bind     complement(2819..2835)

                     /note="M13 fwd"

                     /note="common sequencing primer, one of multiple similar 

                     variants"

     CDS             complement(3542..4204)

                     /codon_start=1

                     /product="replication protein for the broad-host-range 

                     plasmid pBBR1 from Bordetella bronchiseptica"

                     /note="pBBR1 Rep"

                     /translation="MATQSREIGIQAKNKPGHWVQTERKAHEAWAGLIARKPTAAMLLH

                     HLVAQMGHQNAVVVSQKTLSKLIGRSLRTVQYAVKDLVAERWISVVKLNGPGTVSAYVV

                     NDRVAWGQPRDQLRLSVFSAAVVVDHDDQDESLLGHGDLRRIPTLYPGEQQLPTGPGEE

                     PPSQPGIPGMEPDLPALTETEEWERRGQQRLPMPDEPCFLDDGEPLEPPTRVTLPRR"

     rep_origin      4205..4974

                     /note="pBBR1 oriV"

                     /note="replication origin of the broad-host-range plasmid 

                     pBBR1 from Bordetella bronchiseptica; requires the pBBR1 

                     Rep protein for replication"

ORIGIN

        1 accttcggga gcgcctgaag cccgttctgg acgccctggg gccgttgaat cgggatatgc

       61 aggccaaggc cgccgcgatc atcaaggccg tgggcgaaaa gctgctgacg gaacagcggg

      121 aagtccagcg ccagaaacag gcccagcgcc agcaggaacg cgggcgcgca catttccccg

      181 aaaagtgcca cctgggatga atgtcagcta ctgggctatc tggacaaggg aaaacgcaag

      241 cgcaaagaga aagcaggtag cttgcagtgg gcttacatgg cgatagctag actgggcggt

      301 tttatggaca gcaagcgaac cggaattgcc agctggggcg ccctctggta aggttgggaa

      361 gccctgcaaa gtaaactgga tggctttctt gccgccaagg atctgatggc gcaggggatc

      421 aagatctgat caagagacag gatgaggatc gtttcgcatg attgaacaag atggattgca

      481 cgcaggttct ccggccgctt gggtggagag gctattcggc tatgactggg cacaacagac

      541 aatcggctgc tctgatgccg ccgtgttccg gctgtcagcg caggggcgcc cggttctttt

      601 tgtcaagacc gacctgtccg gtgccctgaa tgaactgcag gacgaggcag cgcggctatc

      661 gtggctggcc acgacgggcg ttccttgcgc agctgtgctc gacgttgtca ctgaagcggg

      721 aagggactgg ctgctattgg gcgaagtgcc ggggcaggat ctcctgtcat ctcaccttgc

      781 tcctgccgag aaagtatcca tcatggctga tgcaatgcgg cggctgcata cgcttgatcc

      841 ggctacctgc ccattcgacc accaagcgaa acatcgcatc gagcgagcac gtactcggat

      901 ggaagccggt cttgtcgatc aggatgatct ggacgaagag catcaggggc tcgcgccagc

      961 cgaactgttc gccaggctca aggcgcgcat gcccgacggc gaggatctcg tcgtgaccca

     1021 tggcgatgcc tgcttgccga atatcatggt ggaaaatggc cgcttttctg gattcatcga

     1081 ctgtggccgg ctgggtgtgg cggaccgcta tcaggacata gcgttggcta cccgtgatat

     1141 tgctgaagag cttggcggcg aatgggctga ccgcttcctc gtgctttacg gtatcgccgc

     1201 tcccgattcg cagcgcatcg ccttctatcg ccttcttgac gagttcttct gagcgggact

     1261 ctggggttcg aaatgaccga ccaagcgacg cccaacctgc catcacgaga tttcgattcc

     1321 accgccgcct tctatgaaag gttgggcttc ggaatcgttt tccgggacgc cggctggatg

     1381 atcctccagc gcggggatct catgctggag ttcttcgccc acccccatgg gcaaatatta

     1441 tacgcaaggc gacaaggtgc tgatgccgct ggcgattcag gttcatcatg ccgtttgtga

     1501 tggcttccat gtcggcagaa tgcttaatga attacaacag tttttatgca tgcgcccaat

     1561 acgcaaaccg cctctccccg cgcgttggcc gattcattaa tgcagctggc acgacaggtt

     1621 tcccgactgg aaagcgggca gtgagcgcaa cgcaattaat gtgagttagc tcactcatta

     1681 ggcaccccag gctttacact ttatgcttcc ggctcgtatg ttgtgtggaa ttgtgagcgg

     1741 ataacaattt cacacaggaa acagctatga ccatgattac gccaagcgcg caattaaccc

     1801 tcactaaagg gaacaaaagc tgggtaccgg gccccccctc gaggtcgacc gcggaacccc

     1861 tatttgttta tttttctaaa tacattcaaa tatgtatccg ctcatgagac aataaccctg

     1921 ataaatgctt caataatatt gaaaaaggaa gagtatggtg agcaagggcg aggagctgtt

     1981 caccggggtg gtgcccatcc tggtcgagct ggacggcgac gtaaacggcc acaagttcag

     2041 cgtgtccggc gagggcgagg gcgatgccac ctacggcaag ctgaccctga agttcatctg

     2101 caccaccggc aagctgcccg tgccctggcc caccctcgtg accaccctga cctacggcgt

     2161 gcagtgcttc agccgctacc ccgaccacat gaagcagcac gacttcttca agtccgccat

     2221 gcccgaaggc tacgtccagg agcgcaccat cttcttcaag gacgacggca actacaagac

     2281 ccgcgccgag gtgaagttcg agggcgacac cctggtgaac cgcatcgagc tgaagggcat

     2341 cgacttcaag gaggacggca acatcctggg gcacaagctg gagtacaact acaacagcca

     2401 caacgtctat atcatggccg acaagcagaa gaacggcatc aaggtgaact tcaagatccg

     2461 ccacaacatc gaggacggca gcgtgcagct cgccgaccac taccagcaga acacccccat

     2521 cggcgacggc cccgtgctgc tgcccgacaa ccactacctg agcacccagt ccgccctgag

     2581 caaagacccc aacgagaagc gcgatcacat ggtcctgctg gagttcgtga ccgccgccgg

     2641 gatcactctc ggcatggacg agctgtacaa gtccggactc agatctcgag ctcaagcttc

     2701 gaattctgca gtcgacggta ccgcgggccc gggatccacc ggatctagat aatctagagc

     2761 ggccgccacc gcggtggagc tccaattcgc cctatagtga gtcgtattac gcgcgctcac

     2821 tggccgtcgt tttacaacgt cgtgactggg aaaaccctgg cgttacccaa cttaatcgcc

     2881 ttgcagcaca tccccctttc gccagctggc gtaatagcga agaggcccgc accgatcgcc

     2941 cttcccaaca gttgcgcagc ctgaatggcg aatggaaatt gtaagcgtta atattttgtt

     3001 aaaattcgcg ttaaattttt gttaaatcag ctcatttttt aaccaatagg ccgactgcga

     3061 tgagtggcag ggcggggcgt aattttttta aggcagttat tggtgccctt aaacgcctgg

     3121 tgctacgcct gaataagtga taataagcgg atgaatggca gaaattcgaa agcaaattcg

     3181 acccggtcgt cggttcaggg cagggtcgtt aaatagccgc ttatgtctat tgctggttta

     3241 ccggtttatt gactaccgga agcagtgtga ccgtgtgctt ctcaaatgcc tgaggccagt

     3301 ttgctcaggc tctccccgtg gaggtaataa ttgacgatat gatcatttat tctgcctccc

     3361 agagcctgat aaaaacggtg aatccgttag cgaggtgccg ccggcttcca ttcaggtcga

     3421 ggtggcccgg ctccatgcac cgcgacgcaa cgcggggagg cagacaaggt atagggcggc

     3481 gaggcggcta cagccgatag tctggaacag cgcacttacg ggttgctgcg caacccaagt

     3541 gctaccggcg cggcagcgtg acccgtgtcg gcggctccaa cggctcgcca tcgtccagaa

     3601 aacacggctc atcgggcatc ggcaggcgct gctgcccgcg ccgttcccat tcctccgttt

     3661 cggtcaaggc tggcaggtct ggttccatgc ccggaatgcc gggctggctg ggcggctcct

     3721 cgccggggcc ggtcggtagt tgctgctcgc ccggatacag ggtcgggatg cggcgcaggt

     3781 cgccatgccc caacagcgat tcgtcctggt cgtcgtgatc aaccaccacg gcggcactga

     3841 acaccgacag gcgcaactgg tcgcggggct ggccccacgc cacgcggtca ttgaccacgt

     3901 aggccgacac ggtgccgggg ccgttgagct tcacgacgga gatccagcgc tcggccacca

     3961 agtccttgac tgcgtattgg accgtccgca aagaacgtcc gatgagcttg gaaagtgtct

     4021 tctggctgac caccacggcg ttctggtggc ccatctgcgc cacgaggtga tgcagcagca

     4081 ttgccgccgt gggtttcctc gcaataagcc cggcccacgc ctcatgcgct ttgcgttccg

     4141 tttgcaccca gtgaccgggc ttgttcttgg cttgaatgcc gatttctctg gactgcgtgg

     4201 ccatgcttat ctccatgcgg tagggtgccg cacggttgcg gcaccatgcg caatcagctg

     4261 caacttttcg gcagcgcgac aacaattatg cgttgcgtaa aagtggcagt caattacaga

     4321 ttttctttaa cctacgcaat gagctattgc ggggggtgcc gcaatgagct gttgcgtacc

     4381 cccctttttt aagttgttga tttttaagtc tttcgcattt cgccctatat ctagttcttt

     4441 ggtgcccaaa gaagggcacc cctgcggggt tcccccacgc cttcggcgcg gctccccctc

     4501 cggcaaaaag tggcccctcc ggggcttgtt gatcgactgc gcggccttcg gccttgccca

     4561 aggtggcgct gcccccttgg aacccccgca ctcgccgccg tgaggctcgg ggggcaggcg

     4621 ggcgggcttc gccttcgact gcccccactc gcataggctt gggtcgttcc aggcgcgtca

     4681 aggccaagcc gctgcgcggt cgctgcgcga gccttgaccc gccttccact tggtgtccaa

     4741 ccggcaagcg aagcgcgcag gccgcaggcc ggaggctttt ccccagagaa aattaaaaaa

     4801 attgatgggg caaggccgca ggccgcgcag ttggagccgg tgggtatgtg gtcgaaggct

     4861 gggtagccgg tgggcaatcc ctgtggtcaa gctcgtgggc aggcgcagcc tgtccatcag

     4921 cttgtccagc agggttgtcc acgggccgag cgaagcgagc cagccggtgg ccgctcgcgg

     4981 ccatcgtcca catatccacg ggctggcaag ggagcgcagc gaccgcgcag ggcgaagccc

     5041 ggagagcaag cccgtagggc gccgcagccg ccgtaggcgg tcacgacttt gcgaagcaaa

     5101 gtctagtgag tatactcaag cattgagtgg cccgccggag gcaccgcctt gcgctgcccc

     5161 cgtcgagccg gttggacacc aaaagggagg ggcaggcatg gcggcatacg cgatcatgcg

     5221 atgcaagaag ctggcgaaaa tgggcaacgt ggcggccagt ctcaagcacg cctaccgcga

     5281 gcgcgagacg cccaacgctg acgccagcag gacgccagag aacgagcact gggcggccag

     5341 cagcaccgat gaagcgatgg gccgactgcg cgagttgctg ccagagaagc ggcgcaagga

     5401 cgctgtgttg gcggtcgagt acgtcatgac ggccagcccg gaatggtgga agtcggccag

     5461 ccaagaacag caggcggcgt tcttcgagaa ggcgcacaag tggctggcgg acaagtacgg

     5521 ggcggatcgc atcgtgacgg ccagcatcca ccgtgacgaa accagcccgc acatgaccgc

     5581 gttcgtggtg ccgctgacgc aggacggcag gctgtcggcc aaggagttca tcggcaacaa

     5641 agcgcagatg acccgcgacc agaccacgtt tgcggccgct gtggccgatc tagggctgca

     5701 acggggcatc gagggcagca aggcacgtca cacgcgcatt caggcgttct acgaggccct

     5761 ggagcggcca ccagtgggcc acgtcaccat cagcccgcaa gcggtcgagc cacgcgccta

     5821 tgcaccgcag ggattggccg aaaagctggg aatctcaaag cgcgttgaga cgccggaagc

     5881 cgtggccgac cggctgacaa aagcggttcg gcaggggtat gagcctgccc tacaggccgc

     5941 cgcaggagcg cgtgagatgc gcaagaaggc cgatcaagcc caagagacgg cccgag

//

Caution:
Product is for research use only!

 

Search name

pBBR1MCS2-pAMP-EGFP,Plasmid pBBR1MCS2-pAMP-EGFP,pBBR1MCS2-pAMP-EGFP vector

No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart