pBBR1MCS2- Tac- mCherry

$260.00

  • Model: PVT11376
  • 49 Units in Stock
Ask a question


Add to Cart:

pBBR1MCS2-Tac-mCherry

Catalog No. PVT11376
Packing 2ug

 

pBBR1MCS2-Tac-mCherry Information

Promoter: Tac

Replicator: pBBR1 Rep, pBBR1 oriV

Terminator: T7 Terminator

Plasmid classification: red fluorescent protein expression plasmid; wide host plasmid.

Plasmid size: 6195bp

Plasmid label: mCherry

Prokaryotic resistance: kanamycin Kanamycin

Screening markers: DH5 alpha

Cloned strain: DH5 alpha

Culture conditions: 37 centigrade, aerobic, LB

Expression host: Gram-negative bacteria

5'sequencing primers: M13R:CAGGAAACAGCTATGACC

3'sequencing primers: M13F:TGTAAAACGACGGCCAGT

 

pBBR1MCS2-Tac-mCherry Description
Tac strong promoter activated the expression of mCherry red fluorescent protein.

pBBR1MCS2-Tac-mCherry

 

pBBR1MCS2-Tac-mCherry Sequence

LOCUS       Exported                6195 bp ds-DNA     circular SYN 11-SEP-2016

DEFINITION  synthetic circular DNA

ACCESSION   .

VERSION     .

KEYWORDS    pBBR1MCS2-Tac-mCherry

SOURCE      synthetic DNA construct

  ORGANISM  synthetic DNA construct

REFERENCE   1  (bases 1 to 6195)

  AUTHORS   .

  TITLE     Direct Submission

  JOURNAL   Exported Sunday, September 11, 2016 from SnapGene Viewer 3.1.4

FEATURES             Location/Qualifiers

     source          1..6195

                     /organism="synthetic DNA construct"

                     /mol_type="other DNA"

     CDS             458..1252

                     /codon_start=1

                     /gene="aph(3')-II (or nptII)"

                     /product="aminoglycoside phosphotransferase from Tn5"

                     /note="NeoR/KanR"

                     /note="confers resistance to neomycin, kanamycin, and G418 

                     (Geneticin(R))"

                     /translation="MIEQDGLHAGSPAAWVERLFGYDWAQQTIGCSDAAVFRLSAQGRP

                     VLFVKTDLSGALNELQDEAARLSWLATTGVPCAAVLDVVTEAGRDWLLLGEVPGQDLLS

                     SHLAPAEKVSIMADAMRRLHTLDPATCPFDHQAKHRIERARTRMEAGLVDQDDLDEEHQ

                     GLAPAELFARLKARMPDGEDLVVTHGDACLPNIMVENGRFSGFIDCGRLGVADRYQDIA

                     LATRDIAEELGGEWADRFLVLYGIAAPDSQRIAFYRLLDEFF"

     protein_bind    1657..1678

                     /bound_moiety="E. coli catabolite activator protein"

                     /note="CAP binding site"

                     /note="CAP binding activates transcription in the presence 

                     of cAMP."

     promoter        1693..1723

                     /note="lac promoter"

                     /note="promoter for the E. coli lac operon"

     protein_bind    1731..1747

                     /bound_moiety="lac repressor encoded by lacI"

                     /note="lac operator"

                     /note="The lac repressor binds to the lac operator to 

                     inhibit transcription in E. coli. This inhibition can be 

                     relieved by adding lactose or 

                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."

     primer_bind     1755..1771

                     /note="M13 rev"

                     /note="common sequencing primer, one of multiple similar 

                     variants"

     promoter        1792..1810

                     /note="T3 promoter"

                     /note="promoter for bacteriophage T3 RNA polymerase"

     primer_bind     1840..1856

                     /note="KS primer"

                     /note="common sequencing primer, one of multiple similar 

                     variants"

     promoter        complement(1910..1987)

                     /gene="lacI"

                     /note="lacI promoter"

     misc_feature    2033..2061

                     /note="tac promoter"

                     /note="strong E. coli promoter; hybrid between the trp and 

                     lac UV5 promoters"

     CDS             2108..2818

                     /codon_start=1

                     /product="monomeric derivative of DsRed fluorescent protein

                     (Shaner et al., 2004)"

                     /note="mCherry"

                     /note="mammalian codon-optimized"

                     /translation="MVSKGEEDNMAIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEG

                     TQTAKLKVTKGGPLPFAWDILSPQFMYGSKAYVKHPADIPDYLKLSFPEGFKWERVMNF

                     EDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASSERMYPEDGALK

                     GEIKQRLKLKDGGHYDAEVKTTYKAKKPVQLPGAYNVNIKLDITSHNEDYTIVEQYERA

                     EGRHSTGGMDELYK"

     terminator      2852..2899

                     /note="T7 terminator"

                     /note="transcription terminator for bacteriophage T7 RNA 

                     polymerase"

     primer_bind     complement(2941..2957)

                     /note="SK primer"

                     /note="common sequencing primer, one of multiple similar 

                     variants"

     promoter        complement(2990..3008)

                     /note="T7 promoter"

                     /note="promoter for bacteriophage T7 RNA polymerase"

     primer_bind     complement(3018..3034)

                     /note="M13 fwd"

                     /note="common sequencing primer, one of multiple similar 

                     variants"

     CDS             complement(3741..4403)

                     /codon_start=1

                     /product="replication protein for the broad-host-range 

                     plasmid pBBR1 from Bordetella bronchiseptica"

                     /note="pBBR1 Rep"

                     /translation="MATQSREIGIQAKNKPGHWVQTERKAHEAWAGLIARKPTAAMLLH

                     HLVAQMGHQNAVVVSQKTLSKLIGRSLRTVQYAVKDLVAERWISVVKLNGPGTVSAYVV

                     NDRVAWGQPRDQLRLSVFSAAVVVDHDDQDESLLGHGDLRRIPTLYPGEQQLPTGPGEE

                     PPSQPGIPGMEPDLPALTETEEWERRGQQRLPMPDEPCFLDDGEPLEPPTRVTLPRR"

     rep_origin      4404..5173

                     /note="pBBR1 oriV"

                     /note="replication origin of the broad-host-range plasmid 

                     pBBR1 from Bordetella bronchiseptica; requires the pBBR1 

                     Rep protein for replication"

ORIGIN

        1 accttcggga gcgcctgaag cccgttctgg acgccctggg gccgttgaat cgggatatgc

       61 aggccaaggc cgccgcgatc atcaaggccg tgggcgaaaa gctgctgacg gaacagcggg

      121 aagtccagcg ccagaaacag gcccagcgcc agcaggaacg cgggcgcgca catttccccg

      181 aaaagtgcca cctgggatga atgtcagcta ctgggctatc tggacaaggg aaaacgcaag

      241 cgcaaagaga aagcaggtag cttgcagtgg gcttacatgg cgatagctag actgggcggt

      301 tttatggaca gcaagcgaac cggaattgcc agctggggcg ccctctggta aggttgggaa

      361 gccctgcaaa gtaaactgga tggctttctt gccgccaagg atctgatggc gcaggggatc

      421 aagatctgat caagagacag gatgaggatc gtttcgcatg attgaacaag atggattgca

      481 cgcaggttct ccggccgctt gggtggagag gctattcggc tatgactggg cacaacagac

      541 aatcggctgc tctgatgccg ccgtgttccg gctgtcagcg caggggcgcc cggttctttt

      601 tgtcaagacc gacctgtccg gtgccctgaa tgaactgcag gacgaggcag cgcggctatc

      661 gtggctggcc acgacgggcg ttccttgcgc agctgtgctc gacgttgtca ctgaagcggg

      721 aagggactgg ctgctattgg gcgaagtgcc ggggcaggat ctcctgtcat ctcaccttgc

      781 tcctgccgag aaagtatcca tcatggctga tgcaatgcgg cggctgcata cgcttgatcc

      841 ggctacctgc ccattcgacc accaagcgaa acatcgcatc gagcgagcac gtactcggat

      901 ggaagccggt cttgtcgatc aggatgatct ggacgaagag catcaggggc tcgcgccagc

      961 cgaactgttc gccaggctca aggcgcgcat gcccgacggc gaggatctcg tcgtgaccca

     1021 tggcgatgcc tgcttgccga atatcatggt ggaaaatggc cgcttttctg gattcatcga

     1081 ctgtggccgg ctgggtgtgg cggaccgcta tcaggacata gcgttggcta cccgtgatat

     1141 tgctgaagag cttggcggcg aatgggctga ccgcttcctc gtgctttacg gtatcgccgc

     1201 tcccgattcg cagcgcatcg ccttctatcg ccttcttgac gagttcttct gagcgggact

     1261 ctggggttcg aaatgaccga ccaagcgacg cccaacctgc catcacgaga tttcgattcc

     1321 accgccgcct tctatgaaag gttgggcttc ggaatcgttt tccgggacgc cggctggatg

     1381 atcctccagc gcggggatct catgctggag ttcttcgccc acccccatgg gcaaatatta

     1441 tacgcaaggc gacaaggtgc tgatgccgct ggcgattcag gttcatcatg ccgtttgtga

     1501 tggcttccat gtcggcagaa tgcttaatga attacaacag tttttatgca tgcgcccaat

     1561 acgcaaaccg cctctccccg cgcgttggcc gattcattaa tgcagctggc acgacaggtt

     1621 tcccgactgg aaagcgggca gtgagcgcaa cgcaattaat gtgagttagc tcactcatta

     1681 ggcaccccag gctttacact ttatgcttcc ggctcgtatg ttgtgtggaa ttgtgagcgg

     1741 ataacaattt cacacaggaa acagctatga ccatgattac gccaagcgcg caattaaccc

     1801 tcactaaagg gaacaaaagc tgggtaccgg gccccccctc gaggtcgacg gtatcgataa

     1861 gcttgatatc gaattcgagc tcggtacctc gcgaatgcat ctagatcaca ttcaccaccc

     1921 tgaattgact ctcttccggg cgctatcatg ccataccgcg aaaggttttg cgccattcga

     1981 tggtgtccgg gatctcgacg ctctccctta tgcgactcct gcattaggaa atttgacaat

     2041 taatcatcgg ctcgtataat gtgtggaatg tctcatgagc ggatatttca cacaggaaac

     2101 agtattcatg gtgagcaagg gcgaggagga taacatggcc atcatcaagg agttcatgcg

     2161 cttcaaggtg cacatggagg gctccgtgaa cggccacgag ttcgagatcg agggcgaggg

     2221 cgagggccgc ccctacgagg gcacccagac cgccaagctg aaggtgacca agggtggccc

     2281 cctgcccttc gcctgggaca tcctgtcccc tcagttcatg tacggctcca aggcctacgt

     2341 gaagcacccc gccgacatcc ccgactactt gaagctgtcc ttccccgagg gcttcaagtg

     2401 ggagcgcgtg atgaacttcg aggacggcgg cgtggtgacc gtgacccagg actcctccct

     2461 gcaggacggc gagttcatct acaaggtgaa gctgcgcggc accaacttcc cctccgacgg

     2521 ccccgtaatg cagaagaaga ccatgggctg ggaggcctcc tccgagcgga tgtaccccga

     2581 ggacggcgcc ctgaagggcg agatcaagca gaggctgaag ctgaaggacg gcggccacta

     2641 cgacgctgag gtcaagacca cctacaaggc caagaagccc gtgcagctgc ccggcgccta

     2701 caacgtcaac atcaagttgg acatcacctc ccacaacgag gactacacca tcgtggaaca

     2761 gtacgaacgc gccgagggcc gccactccac cggcggcatg gacgagctgt acaagtaatt

     2821 aacctaggct gctgccaccg ctgagcaata actagcataa ccccttgggg cctctaaacg

     2881 ggtcttgagg ggttttttgc tgaaacctca ggcatttgag aagcacacgg tcacacatcg

     2941 gatccactag ttctagagcg gccgccaccg cggtggagct ccaattcgcc ctatagtgag

     3001 tcgtattacg cgcgctcact ggccgtcgtt ttacaacgtc gtgactggga aaaccctggc

     3061 gttacccaac ttaatcgcct tgcagcacat ccccctttcg ccagctggcg taatagcgaa

     3121 gaggcccgca ccgatcgccc ttcccaacag ttgcgcagcc tgaatggcga atggaaattg

     3181 taagcgttaa tattttgtta aaattcgcgt taaatttttg ttaaatcagc tcatttttta

     3241 accaataggc cgactgcgat gagtggcagg gcggggcgta atttttttaa ggcagttatt

     3301 ggtgccctta aacgcctggt gctacgcctg aataagtgat aataagcgga tgaatggcag

     3361 aaattcgaaa gcaaattcga cccggtcgtc ggttcagggc agggtcgtta aatagccgct

     3421 tatgtctatt gctggtttac cggtttattg actaccggaa gcagtgtgac cgtgtgcttc

     3481 tcaaatgcct gaggccagtt tgctcaggct ctccccgtgg aggtaataat tgacgatatg

     3541 atcatttatt ctgcctccca gagcctgata aaaacggtga atccgttagc gaggtgccgc

     3601 cggcttccat tcaggtcgag gtggcccggc tccatgcacc gcgacgcaac gcggggaggc

     3661 agacaaggta tagggcggcg aggcggctac agccgatagt ctggaacagc gcacttacgg

     3721 gttgctgcgc aacccaagtg ctaccggcgc ggcagcgtga cccgtgtcgg cggctccaac

     3781 ggctcgccat cgtccagaaa acacggctca tcgggcatcg gcaggcgctg ctgcccgcgc

     3841 cgttcccatt cctccgtttc ggtcaaggct ggcaggtctg gttccatgcc cggaatgccg

     3901 ggctggctgg gcggctcctc gccggggccg gtcggtagtt gctgctcgcc cggatacagg

     3961 gtcgggatgc ggcgcaggtc gccatgcccc aacagcgatt cgtcctggtc gtcgtgatca

     4021 accaccacgg cggcactgaa caccgacagg cgcaactggt cgcggggctg gccccacgcc

     4081 acgcggtcat tgaccacgta ggccgacacg gtgccggggc cgttgagctt cacgacggag

     4141 atccagcgct cggccaccaa gtccttgact gcgtattgga ccgtccgcaa agaacgtccg

     4201 atgagcttgg aaagtgtctt ctggctgacc accacggcgt tctggtggcc catctgcgcc

     4261 acgaggtgat gcagcagcat tgccgccgtg ggtttcctcg caataagccc ggcccacgcc

     4321 tcatgcgctt tgcgttccgt ttgcacccag tgaccgggct tgttcttggc ttgaatgccg

     4381 atttctctgg actgcgtggc catgcttatc tccatgcggt agggtgccgc acggttgcgg

     4441 caccatgcgc aatcagctgc aacttttcgg cagcgcgaca acaattatgc gttgcgtaaa

     4501 agtggcagtc aattacagat tttctttaac ctacgcaatg agctattgcg gggggtgccg

     4561 caatgagctg ttgcgtaccc ccctttttta agttgttgat ttttaagtct ttcgcatttc

     4621 gccctatatc tagttctttg gtgcccaaag aagggcaccc ctgcggggtt cccccacgcc

     4681 ttcggcgcgg ctccccctcc ggcaaaaagt ggcccctccg gggcttgttg atcgactgcg

     4741 cggccttcgg ccttgcccaa ggtggcgctg cccccttgga acccccgcac tcgccgccgt

     4801 gaggctcggg gggcaggcgg gcgggcttcg ccttcgactg cccccactcg cataggcttg

     4861 ggtcgttcca ggcgcgtcaa ggccaagccg ctgcgcggtc gctgcgcgag ccttgacccg

     4921 ccttccactt ggtgtccaac cggcaagcga agcgcgcagg ccgcaggccg gaggcttttc

     4981 cccagagaaa attaaaaaaa ttgatggggc aaggccgcag gccgcgcagt tggagccggt

     5041 gggtatgtgg tcgaaggctg ggtagccggt gggcaatccc tgtggtcaag ctcgtgggca

     5101 ggcgcagcct gtccatcagc ttgtccagca gggttgtcca cgggccgagc gaagcgagcc

     5161 agccggtggc cgctcgcggc catcgtccac atatccacgg gctggcaagg gagcgcagcg

     5221 accgcgcagg gcgaagcccg gagagcaagc ccgtagggcg ccgcagccgc cgtaggcggt

     5281 cacgactttg cgaagcaaag tctagtgagt atactcaagc attgagtggc ccgccggagg

     5341 caccgccttg cgctgccccc gtcgagccgg ttggacacca aaagggaggg gcaggcatgg

     5401 cggcatacgc gatcatgcga tgcaagaagc tggcgaaaat gggcaacgtg gcggccagtc

     5461 tcaagcacgc ctaccgcgag cgcgagacgc ccaacgctga cgccagcagg acgccagaga

     5521 acgagcactg ggcggccagc agcaccgatg aagcgatggg ccgactgcgc gagttgctgc

     5581 cagagaagcg gcgcaaggac gctgtgttgg cggtcgagta cgtcatgacg gccagcccgg

     5641 aatggtggaa gtcggccagc caagaacagc aggcggcgtt cttcgagaag gcgcacaagt

     5701 ggctggcgga caagtacggg gcggatcgca tcgtgacggc cagcatccac cgtgacgaaa

     5761 ccagcccgca catgaccgcg ttcgtggtgc cgctgacgca ggacggcagg ctgtcggcca

     5821 aggagttcat cggcaacaaa gcgcagatga cccgcgacca gaccacgttt gcggccgctg

     5881 tggccgatct agggctgcaa cggggcatcg agggcagcaa ggcacgtcac acgcgcattc

     5941 aggcgttcta cgaggccctg gagcggccac cagtgggcca cgtcaccatc agcccgcaag

     6001 cggtcgagcc acgcgcctat gcaccgcagg gattggccga aaagctggga atctcaaagc

     6061 gcgttgagac gccggaagcc gtggccgacc ggctgacaaa agcggttcgg caggggtatg

     6121 agcctgccct acaggccgcc gcaggagcgc gtgagatgcg caagaaggcc gatcaagccc

     6181 aagagacggc ccgag

//

Caution:
1.  This product is FOR RESEARCH USE ONLY!
2.  The item is lyophilized form, Please take the powder plasmid by centrifugation at 5000rpm/min for 1min. Add 20μl ddH2O in to the tube of plasmid.

No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart