pBC- Hygro

$216.00

  • Model: PVT5305
  • 50 Units in Stock
Ask a question


Add to Cart:

pBC-Hygro

PVT5305      2ug

 

pBC-Hygro plasmid information

Promoter: cpc-1
Replicator: pUC ori, F1 ori
Terminator: trpC
Plasmid classification: other host shuttle vectors; filamentous fungal expression plasmids
Plasmid size: 6817bp
Plasmid label: LacZ
Prokaryotic resistance: chloramphenicol chloramphenicol
Screening markers: hygromycin Hygromycin
Cloned strain: DH5 alpha
Culture conditions: 37 centigrade, aerobic, LB
Expression host: filamentous fungi
5'sequencing primers: M13F:TGTAAAACGACGGCCAGT
3'sequencing primers: M13R:CAGGAAACAGCTATGACC
Use:Filamentous fungal plasmid
 

pBC-Hygro plasmid description

PBC-hygro is a filamentous fungal expression vector with ApaI, XhoI, SalI, ClaI, HindIII, EcoRI, SmaI, SpeI, XbaI, NotI.


pBC-Hygro Plasmid

 


pBC-Hygro plasmid Sequence
 

LOCUS       Exported                6817 bp ds-DNA     circular SYN 30-AUG-2016

DEFINITION  synthetic circular DNA.

ACCESSION   .

VERSION     .

KEYWORDS    pBC-hygro

SOURCE      synthetic DNA construct

  ORGANISM  synthetic DNA construct

REFERENCE   1  (bases 1 to 6817)

  AUTHORS   .

  TITLE     Direct Submission

  JOURNAL   Exported 2016-02-20 

REFERENCE   2  (bases 1 to 6817)

  AUTHORS   .

  TITLE     Direct Submission

REFERENCE   3  (bases 1 to 6817)

  AUTHORS   .

  TITLE     Direct Submission

  JOURNAL   Exported Tuesday, August 30, 2016 from SnapGene Viewer 3.1.4

FEATURES             Location/Qualifiers

     source          1..6817

                     /organism="synthetic DNA construct"

                     /mol_type="other DNA"

     rep_origin      complement(3..458)

                     /direction=LEFT

                     /note="f1 ori"

                     /note="f1 ori;f1 ori;f1 bacteriophage origin of 

                     replication; arrow indicates direction of (+) strand 

                     synthesis"

     CDS             complement(241..816)

                     /codon_start=1

                     /gene="lacZ fragment"

                     /product="LacZ-alpha fragment of beta-galactosidase"

                     /note="lacZ"

                     /note="lacZ fragment;lacZ-alpha"

                     /translation="MTMITPSAQLTLTKGNKSWSSTAVAAALELVDPPGCRNSISSLSI

                     PSTSRGGPVPNSPYSESYYARSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAR

                     TDRPSQQLRSLNGEWDAPCSGALSAAGVVVTRSVTATLASALAPAPFAFFPSFLATFAG

                     FPRQALNRGLPLGFRFSALRHLDPKKLD"

     primer_bind     600..616

                     /note="M13 fwd"

                     /note="M13 fwd;M13 fwd;common sequencing primer, one of 

                     multiple similar variants"

     promoter        626..644

                     /note="T7 promoter"

                     /note="T7 promoter;T7 promoter;promoter for bacteriophage 

                     T7 RNA polymerase"

     misc_feature    653..760

                     /note="MCS"

                     /note="MCS;MCS;pBluescript multiple cloning site"

     primer_bind     670..686

                     /note="KS primer"

                     /note="KS primer;KS primer;common sequencing primer, one of

                     multiple similar variants"

     primer_bind     complement(720..736)

                     /note="SK primer"

                     /note="SK primer;SK primer;common sequencing primer, one of

                     multiple similar variants"

     promoter        complement(773..791)

                     /note="T3 promoter"

                     /note="T3 promoter;T3 promoter;promoter for bacteriophage 

                     T3 RNA polymerase"

     primer_bind     complement(812..828)

                     /note="M13 rev"

                     /note="M13 rev;M13 rev;common sequencing primer, one of 

                     multiple similar variants"

     protein_bind    836..852

                     /bound_moiety="lac repressor encoded by lacI"

                     /note="laco"

                     /note="lac repressor encoded by lacI lac operator;lac 

                     operator;The lac repressor binds to the lac operator to 

                     inhibit transcription in E. coli. This inhibition can be 

                     relieved by adding lactose or 

                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."

     promoter        complement(860..890)

                     /note="lac promoter"

                     /note="lac promoter;lac promoter;promoter for the E. coli 

                     lac operon"

     protein_bind    905..926

                     /bound_moiety="E. coli catabolite activator protein"

                     /note="CAP"

                     /note="E. coli catabolite activator protein CAP bindin;CAP 

                     binding site;CAP binding activates transcription in the 

                     presence of cAMP."

     rep_origin      complement(1214..1802)

                     /direction=LEFT

                     /note="ori"

                     /note="ori;ori;high-copy-number ColE1/pMB1/pBR322/pUC 

                     origin of replication"

     promoter        2022..2124

                     /note="cat promoter"

                     /note="cat promoter;cat promoter;promoter of the E. coli 

                     cat gene encoding chloramphenicol acetyltransferase"

     CDS             2125..2784

                     /codon_start=1

                     /gene="cat"

                     /product="chloramphenicol acetyltransferase"

                     /note="Chl"

                     /note="cat;CmR;confers resistance to chloramphenicol"

                     /translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL

                     KTVKKNKHKFYPAFIHILARLMNAHPELRMAMKDGELVIWDSVHPCYTVFHEQTETFSS

                     LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM

                     DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGGA"

     misc_feature    3732..4535

                     /note="CPC-1 Promoter"

     CDS             4541..5566

                     /codon_start=1

                     /gene="aph(4)-Ia"

                     /product="aminoglycoside phosphotransferase from E. coli"

                     /note="aph"

                     /note="aph(4)-Ia;HygR;confers resistance to hygromycin"

                     /translation="MKKPELTATSVEKFLIEKFDSVSDLMQLSEGEESRAFSFDVGGRG

                     YVLRVNSCADGFYKDRYVYRHFASAALPIPEVLDIGEFSESLTYCISRRAQGVTLQDLP

                     ETELPAVLQPVAEAMDAIAAADLSQTSGFGPFGPQGIGQYTTWRDFICAIADPHVYHWQ

                     TVMDDTVSASVAQALDELMLWAEDCPEVRHLVHADFGSNNVLTDNGRITAVIDWSEAMF

                     GDSQYEVANIFFWRPWLACMEQQTRYFERRHPELAGSPRLRAYMLRIGLDQLYQSLVDG

                     NFDDAAWAQGRCDAIVRSGAGTVGRTQIARRSAAVWTDGCVEVLADSGNRRPSTRPRAK

                     E"

     misc_feature    5567..6501

                     /note="trpC Terminator"

     promoter        complement(6689..6794)

                     /gene="bla"

                     /note="bla bla AmpR promoter"

                     /note="bla AmpR promoter;AmpR promoter"

ORIGIN

        1 ctaaattgta agcgttaata ttttgttaaa attcgcgtta aatttttgtt aaatcagctc

       61 attttttaac caataggccg aaatcggcaa aatcccttat aaatcaaaag aatagaccga

      121 gatagggttg agtgttgttc cagtttggaa caagagtcca ctattaaaga acgtggactc

      181 caacgtcaaa gggcgaaaaa ccgtctatca gggcgatggc ccactacgtg aaccatcacc

      241 ctaatcaagt tttttggggt cgaggtgccg taaagcacta aatcggaacc ctaaagggag

      301 cccccgattt agagcttgac ggggaaagcc ggcgaacgtg gcgagaaagg aagggaagaa

      361 agcgaaagga gcgggcgcta gggcgctggc aagtgtagcg gtcacgctgc gcgtaaccac

      421 cacacccgcc gcgcttaatg cgccgctaca gggcgcgtcc cattcgccat tcaggctgcg

      481 caactgttgg gaagggcgat cggtgcgggc ctcttcgcta ttacgccagc tggcgaaagg

      541 gggatgtgct gcaaggcgat taagttgggt aacgccaggg ttttcccagt cacgacgttg

      601 taaaacgacg gccagtgagc gcgcgtaata cgactcacta tagggcgaat tgggtaccgg

      661 gccccccctc gaggtcgacg gtatcgataa gcttgatatc gaattcctgc agcccggggg

      721 atccactagt tctagagcgg ccgccaccgc ggtggagctc cagcttttgt tccctttagt

      781 gagggttaat tgcgcgcttg gcgtaatcat ggtcatagct gtttcctgtg tgaaattgtt

      841 atccgctcac aattccacac aacatacgag ccggaagcat aaagtgtaaa gcctggggtg

      901 cctaatgagt gagctaactc acattaattg cgttgcgctc actgcccgct ttccagtcgg

      961 gaaacctgtc gtgccagctg cattaatgaa tcggccaacg cgcggggaga ggcggtttgc

     1021 gtattgggcg ctcttccgct tcctcgctca ctgactcgct gcgctcggtc gttcggctgc

     1081 ggcgagcggt atcagctcac tcaaaggcgg taatacggtt atccacagaa tcaggggata

     1141 acgcaggaaa gaacatgtga gcaaaaggcc agcaaaaggc caggaaccgt aaaaaggccg

     1201 cgttgctggc gtttttccat aggctccgcc cccctgacga gcatcacaaa aatcgacgct

     1261 caagtcagag gtggcgaaac ccgacaggac tataaagata ccaggcgttt ccccctggaa

     1321 gctccctcgt gcgctctcct gttccgaccc tgccgcttac cggatacctg tccgcctttc

     1381 tcccttcggg aagcgtggcg ctttctcata gctcacgctg taggtatctc agttcggtgt

     1441 aggtcgttcg ctccaagctg ggctgtgtgc acgaaccccc cgttcagccc gaccgctgcg

     1501 ccttatccgg taactatcgt cttgagtcca acccggtaag acacgactta tcgccactgg

     1561 cagcagccac tggtaacagg attagcagag cgaggtatgt aggcggtgct acagagttct

     1621 tgaagtggtg gcctaactac ggctacacta gaaggacagt atttggtatc tgcgctctgc

     1681 tgaagccagt taccttcgga aaaagagttg gtagctcttg atccggcaaa caaaccaccg

     1741 ctggtagcgg tggttttttt gtttgcaagc agcagattac gcgcagaaaa aaaggatctc

     1801 aagaagatcc tttgatcttt tctacggggt ctgacgctca gtggaacgaa aactcacgtt

     1861 aagggatttt ggtcatgaga ttatcaaaaa ggatcttcac ctagatcctt ttcgaccgaa

     1921 taaatacctg tgacggaaga tcacttcgca gaataaataa atcctggtgt ccctgttgat

     1981 accgggaagc cctgggccaa cttttggcga aaatgagacg ttgatcggca cgtaagaggt

     2041 tccaactttc accataatga aataagatca ctaccgggcg tattttttga gttgtcgaga

     2101 ttttcaggag ctaaggaagc taaaatggag aaaaaaatca ctggatatac caccgttgat

     2161 atatcccaat ggcatcgtaa agaacatttt gaggcatttc agtcagttgc tcaatgtacc

     2221 tataaccaga ccgttcagct ggatattacg gcctttttaa agaccgtaaa gaaaaataag

     2281 cacaagtttt atccggcctt tattcacatt cttgcccgcc tgatgaatgc tcatccggaa

     2341 ttacgtatgg caatgaaaga cggtgagctg gtgatatggg atagtgttca cccttgttac

     2401 accgttttcc atgagcaaac tgaaacgttt tcatcgctct ggagtgaata ccacgacgat

     2461 ttccggcagt ttctacacat atattcgcaa gatgtggcgt gttacggtga aaacctggcc

     2521 tatttcccta aagggtttat tgagaatatg tttttcgtct cagccaatcc ctgggtgagt

     2581 ttcaccagtt ttgatttaaa cgtggccaat atggacaact tcttcgcccc cgttttcacc

     2641 atgggcaaat attatacgca aggcgacaag gtgctgatgc cgctggcgat tcaggttcat

     2701 catgccgttt gtgatggctt ccatgtcggc agaatgctta atgaattaca acagtactgc

     2761 gatgagtggc agggcggggc gtaatttttt taaggcagtt attggtgccc ttaaacgcct

     2821 ggttgctacg cctgaataag tgataataag cggatgaatg gcagaaattc gaaagcaaat

     2881 tcgacccggt cgtcggttca gggcagggtc gttaaatagc cgcttatgtc tattgctggt

     2941 ttaccggttt attgactacc ggaagcagtg tgaccgtgtg cttctcaaat gcctgaggcc

     3001 agtttgctca ggctctcccc gtggaggtaa taattgacga tatgatcctt tttttctgat

     3061 caaaagtgct catcattgga aaaccgagat gcgccgcgtg cggctgctgg agatggcgga

     3121 cgcgatggat atgttctgcc aagggttggt ttgcgcattc acagttctcc gcaagaattg

     3181 attggctcca attcttggag tggtgaatcc gttagcgagg tgccgccggc ttccattcag

     3241 gtcgaggtgg cccggctcca tgcaccgcga cgcaacgcgg ggaggcagac aaggtatagg

     3301 gcggcgccta caatccatgc caacccgttc catgtgctcg ccgaggcggc ataaatcgcc

     3361 gtgacgatca gcggtccaat gatcgaagtt aggctggtaa gagccgcgag cgatccttga

     3421 agctgtccct gatggtcgtc atctacctgc ctggacagca tggcctgcaa cgcgggcatc

     3481 ccgatgccgc cggaagcgag aagaatcata atggggaagg ccatccagcc tcgcgtcgag

     3541 ctttgaagtt gctgcaagct ggcttcaagc catcccatcc gaatgtgatg gatgcgttct

     3601 ttctgggccg ttgcgacttt ggggatcgtc tttcccgcgc ccttggttgg aggccctgtc

     3661 tccggtgtcc cttgtccctt ccaggcaagc gagcgaggtc cattcagatg gtgctccatc

     3721 agcgttggct ttccgtctcc attggctctt ggcaattcgg tcagcggggc tgactgcctc

     3781 aggtggggca gtgctagtgt gtgtaccgac ccgcaggatt ggtgctttgc ccagagctct

     3841 acagaatagc gcgcgcatcc atatgttagt tctgcaattt tcttgtatcg gtgctgtgac

     3901 tcatacttcc ccctttggct ggccttgcgg caaccaataa gaacgcacag tgaaatcttg

     3961 cgggtgggga gtggatccat ggcgcctgca ttggcttggg gacgcgcact gtcgcacact

     4021 tccatctgac ctttcagaag ggtttcgtgg tgggcaagga ccaaccggtt gcgcggccgt

     4081 gcgtgggtgc ctcgcccggc actgccaggg ccactgcagt ggcagtttgc tgcctgatac

     4141 aaaatccttc cctccgccca gttttccctc tttgaccttc ctttctcttc tctgcaacca

     4201 aatccaccct atcaaaccaa aacagtatct cgaccgaggt atcaacctga atcagcaaca

     4261 tcgtagccag catttgtctc cgtctctgca gaaccagcga gttgcaaaca ttatccaggc

     4321 aacagggcac caactcactt cttcggcttt caccaatcgg tacagctctt ctcagaactc

     4381 gcgtccgcaa cagttctacg cttcctcagc accttcttca gcttcaatcc tgaacactca

     4441 gaaccgcgca cagcagcgcc ctcctgttcc cttgtttccc aaaagtaccg gtagtatttc

     4501 gcacggaaag cagggcaaca agatgttctc aggtacccat atgaaaaagc ctgaactcac

     4561 cgcgacgtct gtcgagaagt ttctgatcga aaagttcgac agcgtctccg acctgatgca

     4621 gctctcggag ggcgaagaat ctcgtgcttt cagcttcgat gtaggagggc gtggatatgt

     4681 cctgcgggta aatagctgcg ccgatggttt ctacaaagat cgttatgttt atcggcactt

     4741 tgcatcggcc gcgctcccga ttccggaagt gcttgacatt ggggaattca gcgagagcct

     4801 gacctattgc atctcccgcc gtgcacaggg tgtcacgttg caagacctgc ctgaaaccga

     4861 actgcccgct gttctgcagc cggtcgcgga ggccatggat gcgatcgctg cggccgatct

     4921 tagccagacg agcgggttcg gcccattcgg accgcaagga atcggtcaat acactacatg

     4981 gcgtgatttc atatgcgcga ttgctgatcc ccatgtgtat cactggcaaa ctgtgatgga

     5041 cgacaccgtc agtgcgtccg tcgcgcaggc tctcgatgag ctgatgcttt gggccgagga

     5101 ctgccccgaa gtccggcacc tcgtgcacgc ggatttcggc tccaacaatg tcctgacgga

     5161 caatggccgc ataacagcgg tcattgactg gagcgaggcg atgttcgggg attcccaata

     5221 cgaggtcgcc aacatcttct tctggaggcc gtggttggct tgtatggagc agcagacgcg

     5281 ctacttcgag cggaggcatc cggagcttgc aggatcgccg cggctccggg cgtatatgct

     5341 ccgcattggt cttgaccaac tctatcagag cttggttgac ggcaatttcg atgatgcagc

     5401 ttgggcgcag ggtcgatgcg acgcaatcgt ccgatccgga gccgggactg tcgggcgtac

     5461 acaaatcgcc cgcagaagcg cggccgtctg gaccgatggc tgtgtagaag tactcgccga

     5521 tagtggaaac cgacgcccca gcactcgtcc gagggcaaag gaatagagta gatgccgacc

     5581 gggatccact taacgttact gaaatcatca aacagcttga cgaatctgga tataagatcg

     5641 ttggtgtcga tgtcagctcc ggagttgaga caaatggtgt tcaggatctc gataagatac

     5701 gttcatttgt ccaagcagca aagagtgcct tctagtgatt taatagctcc atgtcaacaa

     5761 gaataaaacg cgtttcgggt ttacctcttc cagatacagc tcatctgcaa tgcattaatg

     5821 cattggacct cgcaacccta gtacgccctt caggctccgg cgaagcagaa gaatagctta

     5881 gcagagtcta ttttcatttt cgggagacga gatcaagcag atcaacggtc gtcaagagac

     5941 ctacgagact gaggaatccg ctcttggctc cacgcgacta tatatttgtc tctaattgta

     6001 ctttgacatg ctcctcttct ttactctgat agcttgacta tgaaaattcc gtcaccagcc

     6061 cctgggttcg caaagataat tgcactgttt cttccttgaa ctctcaagcc tacaggacac

     6121 acattcatcg taggtataaa cctcgaaaat cattcctact aagatgggta tacaatagta

     6181 accatggttg cctagtgaat gctccgtaac acccaatacg ccggccgaaa cttttttaca

     6241 actctcctat gagtcgttta cccagaatgc acaggtacac ttgtttagag gtaatccttc

     6301 tttctagcta gaggatcctc tacgccggac gcatcgtggc cggcatcacc ggcgccacag

     6361 gtgcggttgc tggcgcctat atcgccgaca tcaccgatgg ggaagatcgg gctcgccact

     6421 tcgggctcat gagcgcttgt ttcggcgtgg gtatggtggc aggccccgtg gccgggggac

     6481 tgttgggcgc catctccttg cgttcttcgg ggcgaaaact ctcaaggatc ttaccgctgt

     6541 tgagatccag ttcgatgtaa cccactcgtg cacccaactg atcttcagca tcttttactt

     6601 tcaccagcgt ttctgggtga gcaaaaacag gaaggcaaaa tgccgcaaaa aagggaataa

     6661 gggcgacacg gaaatgttga atactcatac tcttcctttt tcaatattat tgaagcattt

     6721 atcaagggtt attgtctcat gagcggatac atatttgaat gtatttagaa aaataaacaa

     6781 ataggggttc cgcgcacatt tccccgaaaa gtgccac

//

 

Caution:
Product is for research use only!

 

Search name

pBC-Hygro,Plasmid pBC-Hygro,pBC-Hygro vector

No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart