pBC- Hygro Plasmid

$216.00

  • Model: PVT5305
  • 50 Units in Stock
Ask a question


Add to Cart:

pBC-Hygro

Search name

pBC-Hygro,Plasmid pBC-Hygro,pBC-Hygro vector

pBC-Hygro plasmid information

Promoter: cpc-1
Replicator: pUC ori, F1 ori
Terminator: trpC
Plasmid classification: other host shuttle vectors; filamentous fungal expression plasmids
Plasmid size: 6817bp
Plasmid label: LacZ
Prokaryotic resistance: chloramphenicol chloramphenicol
Screening markers: hygromycin Hygromycin
Cloned strain: DH5 alpha
Culture conditions: 37 centigrade, aerobic, LB
Expression host: filamentous fungi
5'sequencing primers: M13F:TGTAAAACGACGGCCAGT
3'sequencing primers: M13R:CAGGAAACAGCTATGACC
Use:Filamentous fungal plasmid

pBC-Hygro plasmid description
PBC-hygro is a filamentous fungal expression vector with ApaI, XhoI, SalI, ClaI, HindIII, EcoRI, SmaI, SpeI, XbaI, NotI.
pBC-Hygro Plasmid

 

pBC-Hygro plasmid Sequence
 

LOCUS       Exported                6817 bp ds-DNA     circular SYN 30-AUG-2016
DEFINITION  synthetic circular DNA.
ACCESSION   .
VERSION     .
KEYWORDS    pBC-hygro
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 6817)
  AUTHORS   .
  TITLE     Direct Submission
  JOURNAL   Exported 2016-02-20 
REFERENCE   2  (bases 1 to 6817)
  AUTHORS   .
  TITLE     Direct Submission
REFERENCE   3  (bases 1 to 6817)
  AUTHORS   .
  TITLE     Direct Submission
  JOURNAL   Exported Tuesday, August 30, 2016 from SnapGene Viewer 3.1.4
            http://www.miaolingbio.com
FEATURES             Location/Qualifiers
     source          1..6817
                     /organism="synthetic DNA construct"
                     /mol_type="other DNA"
     rep_origin      complement(3..458)
                     /direction=LEFT
                     /note="f1 ori"
                     /note="f1 ori;f1 ori;f1 bacteriophage origin of 
                     replication; arrow indicates direction of (+) strand 
                     synthesis"
     CDS             complement(241..816)
                     /codon_start=1
                     /gene="lacZ fragment"
                     /product="LacZ-alpha fragment of beta-galactosidase"
                     /note="lacZ"
                     /note="lacZ fragment;lacZ-alpha"
                     /translation="MTMITPSAQLTLTKGNKSWSSTAVAAALELVDPPGCRNSISSLSI
                     PSTSRGGPVPNSPYSESYYARSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAR
                     TDRPSQQLRSLNGEWDAPCSGALSAAGVVVTRSVTATLASALAPAPFAFFPSFLATFAG
                     FPRQALNRGLPLGFRFSALRHLDPKKLD"
     primer_bind     600..616
                     /note="M13 fwd"
                     /note="M13 fwd;M13 fwd;common sequencing primer, one of 
                     multiple similar variants"
     promoter        626..644
                     /note="T7 promoter"
                     /note="T7 promoter;T7 promoter;promoter for bacteriophage 
                     T7 RNA polymerase"
     misc_feature    653..760
                     /note="MCS"
                     /note="MCS;MCS;pBluescript multiple cloning site"
     primer_bind     670..686
                     /note="KS primer"
                     /note="KS primer;KS primer;common sequencing primer, one of
                     multiple similar variants"
     primer_bind     complement(720..736)
                     /note="SK primer"
                     /note="SK primer;SK primer;common sequencing primer, one of
                     multiple similar variants"
     promoter        complement(773..791)
                     /note="T3 promoter"
                     /note="T3 promoter;T3 promoter;promoter for bacteriophage 
                     T3 RNA polymerase"
     primer_bind     complement(812..828)
                     /note="M13 rev"
                     /note="M13 rev;M13 rev;common sequencing primer, one of 
                     multiple similar variants"
     protein_bind    836..852
                     /bound_moiety="lac repressor encoded by lacI"
                     /note="laco"
                     /note="lac repressor encoded by lacI lac operator;lac 
                     operator;The lac repressor binds to the lac operator to 
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     promoter        complement(860..890)
                     /note="lac promoter"
                     /note="lac promoter;lac promoter;promoter for the E. coli 
                     lac operon"
     protein_bind    905..926
                     /bound_moiety="E. coli catabolite activator protein"
                     /note="CAP"
                     /note="E. coli catabolite activator protein CAP bindin;CAP 
                     binding site;CAP binding activates transcription in the 
                     presence of cAMP."
     rep_origin      complement(1214..1802)
                     /direction=LEFT
                     /note="ori"
                     /note="ori;ori;high-copy-number ColE1/pMB1/pBR322/pUC 
                     origin of replication"
     promoter        2022..2124
                     /note="cat promoter"
                     /note="cat promoter;cat promoter;promoter of the E. coli 
                     cat gene encoding chloramphenicol acetyltransferase"
     CDS             2125..2784
                     /codon_start=1
                     /gene="cat"
                     /product="chloramphenicol acetyltransferase"
                     /note="Chl"
                     /note="cat;CmR;confers resistance to chloramphenicol"
                     /translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL
                     KTVKKNKHKFYPAFIHILARLMNAHPELRMAMKDGELVIWDSVHPCYTVFHEQTETFSS
                     LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM
     
No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart