pBE2R- EGFP

  • Model: PVT11298
  • 0 Units in Stock
Ask a question


 Sold Out 

pBE2R-EGFP


Catalog No. PVT11298
Packing 2ug

 

pBE2R-EGFP Information
Function /
Resistance Amp
Screen /
Strain DH5alpha
Culture temperature 37degrees centigrade

pBE2R-EGFP Description
PBE2R-EGFP is a fluorescent expression plasmid of Bacillus subtilis.

 

pBE2R-EGFP Sequence
 

LOCUS       Exported                7713 bp ds-DNA     circular SYN 29-SEP-2017

DEFINITION  synthetic circular DNA

ACCESSION   .

VERSION     .

KEYWORDS    .

SOURCE      synthetic DNA construct

  ORGANISM  synthetic DNA construct

REFERENCE   1  (bases 1 to 7713)

  AUTHORS   .

  TITLE     Direct Submission

  JOURNAL   Exported Sep 29, 2017

FEATURES             Location/Qualifiers

     source          1..7713

                     /organism="synthetic DNA construct"

                     /mol_type="other DNA"

     misc_feature    419..723

                     /label=P43

     misc_feature    756..1088

                     /label=Apr sp+pro

     CDS             1095..1811

                     /codon_start=1

                     /product="enhanced GFP"

                     /label=EGFP

                     /note="mammalian codon-optimized"

                     /translation="MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTL

                     KFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDD

                     GNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIK

                     VNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLL

                     EFVTAAGITLGMDELYK"

     CDS             1818..1835

                     /codon_start=1

                     /product="6xHis affinity tag"

                     /label=6xHis

                     /translation="HHHHHH"

     promoter        2652..2756

                     /gene="bla"

                     /label=AmpR promoter

     CDS             2757..3617

                     /codon_start=1

                     /gene="bla"

                     /product="beta-lactamase"

                     /label=AmpR

                     /note="confers resistance to ampicillin, carbenicillin, and

                     related antibiotics"

                     /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI

                     ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVEYS

                     PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW

                     EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA

                     LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS

                     LIKHW"

     rep_origin      3788..4376

                     /direction=RIGHT

                     /label=ColE1 ori

                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 

                     replication"

     CDS             complement(5779..6549)

                     /codon_start=1

                     /label=Kan

                     /translation="MRIVNGPIIMTREERMKIVHEIKERILDKYGDDVKAIGVYGSLGR

                     QTDGPYSDIEMMCVMSTEEAEFSHEWTTGEWKVEVNFDSEEILLDYASQVESDWPLTHG

                     QFFSILPIYDSGGYLEKVYQTAKSVEAQTFHDAICALIVEELFEYAGKWRNIRVQGPTT

                     FLPSLTVQVAMAGAMLIGLHHRICYTTSASVLTEAVKQSDLPSGYDHLCQFVMSGQLSD

                     SEKLLESLENFWNGIQEWTERHGYIVDVSKRIPF"

     CDS             complement(6709..7713)

                     /codon_start=1

                     /gene="repB"

                     /product="RepB replication protein"

                     /label=repB

                     /note="from Enterococcus faecalis plasmid pAM-alpha-1"

                     /db_xref="GI:22652809"

                     /protein_id="AAN03827.1"

                     /translation="MGVSFNIMCPNSSIYSDEKSRVLVDKTKSGKVRPWREKKIANVDY

                     FELLHILEFKKAERVKDCAEILEYKQNRETGERKLYRVWFCKSRLCPMCNWRRAMKHGI

                     QSQKVVAEVIKQKPTVRWLFLTLTVKNVYDGEELNKSLSDMAQGFRRMMQYKKINKNLV

                     GFMRATEVTINNKDNSYNQHMHVLVCVEPTYFKNTENYVNQKQWIQFWKKAMKLDYDPN

                     VKVQMIRPKNKYKSDIQSAIDETAKYPVKDTDFMTDDEEKNLKRLSDLEEGLHRKRLIS

                     YGGLLKEIHKKLNLDDTEEGDLIHTDDDEKADEDGFSIIAMWNWERKNYFIKE"

ORIGIN

        1 ctatttagtt atttgtttag tcacttataa ctttaacaga tggggttttt ctgtgcaacc

       61 aattttaagg gttttcaata ctttaaaaca catacatacc aacacttcaa cgcacctttc

      121 agcaactaaa ataaaaatga cgttatttct atatgtatca agataagaaa gaacaagttc

      181 aaaaccatca aaaaaagaca ccttttcagg tgcttttttt attttataaa ctcattccct

      241 gatctcgact tcgttctttt tttacctctc ggttatgagt tagttcaaat tcgttctttt

      301 taggttctaa atcgtgtttt tcttggaatt gtgctgtttt atcctttacc ttgtctacaa

      361 accccttaaa aacgttttta aaggctttta agccgtctgt acgttcctta aggaattcga

      421 gctcagcttt attgagtgga tgattatatt ccttttgata ggtggtatgt tttcgcttga

      481 acttttaaat acagccattg aacatacggt tgatttaata actgacaaac atcaccctct

      541 tgctaaagcg gccaaggacg ctgccgccgg ggctgtttgc gtttttgccg tgatttcgtg

      601 tattattggt ttacttattt ttttgccaaa gctgtaatgg ctgaaaattc ttacatttat

      661 tttacatttt tagaaatggg cgtgaaaaaa agcgcgcgat tatgtaaaat ataaagtgat

      721 agcggtacca ttataggtaa gagaggaatg tacacatgaa gaaaccgttg gggaaaattg

      781 tcgcaagcac cgcactactc atttctgttg cttttagttc atcgatcgca tcggctgctg

      841 aagaagcaaa agaaaaatat ttaattggct ttaatgagca ggaagctgtc agtgagtttg

      901 tagaacaagt agaggcaaat gacgaggtcg ccattctctc tgaggaagag gaagtcgaaa

      961 ttgaattgct tcatgaattt gaaacgattc ctgttttatc cgttgagtta agcccagaag

     1021 atgtggacgc gcttgaactc gatccagcga tttcttatat tgaagaggat gcagaagtaa

     1081 cgacaatggg atccatggtg agcaagggcg aggagctgtt caccggggtg gtgcccatcc

     1141 tggtcgagct ggacggcgac gtaaacggcc acaagttcag cgtgtccggc gagggcgagg

     1201 gcgatgccac ctacggcaag ctgaccctga agttcatctg caccaccggc aagctgcccg

     1261 tgccctggcc caccctcgtg accaccctga cctacggcgt gcagtgcttc agccgctacc

     1321 ccgaccacat gaagcagcac gacttcttca agtccgccat gcccgaaggc tacgtccagg

     1381 agcgcaccat cttcttcaag gacgacggca actacaagac ccgcgccgag gtgaagttcg

     1441 agggcgacac cctggtgaac cgcatcgagc tgaagggcat cgacttcaag gaggacggca

     1501 acatcctggg gcacaagctg gagtacaact acaacagcca caacgtctat atcatggccg

     1561 acaagcagaa gaacggcatc aaggtgaact tcaagatccg ccacaacatc gaggacggca

     1621 gcgtgcagct cgccgaccac taccagcaga acacccccat cggcgacggc cccgtgctgc

     1681 tgcccgacaa ccactacctg agcacccagt ccgccctgag caaagacccc aacgagaagc

     1741 gcgatcacat ggtcctgctg gagttcgtga ccgccgccgg gatcactctc ggcatggacg

     1801 agctgtacaa gctcgagcac caccaccacc accacaagct tgtattctat atagtgtcac

     1861 ctaaatcgta tgtgtatgat acataaggtt atgtattaat tgtagccgcg ttctaacgac

     1921 aatatgtaca agcctaattg tgtagcatct ggcttactga agcagaccct atcatctctc

     1981 tcgtaaactg ccgtcagagt cggtttggtt ggacgaacct tctgagtttc tggtaacgcc

     2041 gttccgcacc ccggaaatgg tcagcgaacc aatcagcagg gtcatcgcta gccagatcct

     2101 ctacgccgga cgcatcgtgg ccggcatcac cggcgccaca ggtgcggttg ctggcgccta

     2161 tatcgccgac atcaccgatg gggaagatcg ggctcgccac ttcgggctca tgagcgcttg

     2221 tttcggcgtg ggtatggtgg caggccccgt ggccggggga ctgttgggcg ccatctcctt

     2281 gcaccattcc ttgcggcggc ggtgctcaac ggcctcaacc tactactggg ctgcttccta

     2341 atgcaggagt cgcataaggg agagcgtcga tatggtgcac tctcagtaca atctgctctg

     2401 atgccgcata gttaagccag ccccgacacc cgccaacacc cgctgacgcg ccctgacggg

     2461 cttgtctgct cccggcatcc gcttacagac aagctgtgac cgtctccggg agctgcatgt

     2521 gtcagaggtt ttcaccgtca tcaccgaaac gcgcgagacg aaagggcctc gtgatacgcc

     2581 tatttttata ggttaatgtc atgataataa tggtttctta gacgtcaggt ggcacttttc

     2641 ggggaaatgt gcgcggaacc cctatttgtt tatttttcta aatacattca aatatgtatc

     2701 cgctcatgag acaataaccc tgataaatgc ttcaataata ttgaaaaagg aagagtatga

     2761 gtattcaaca tttccgtgtc gcccttattc ccttttttgc ggcattttgc cttcctgttt

     2821 ttgctcaccc agaaacgctg gtgaaagtaa aagatgctga agatcagttg ggtgcacgag

     2881 tgggttacat cgaactggat ctcaacagcg gtaagatcct tgagagtttt cgccccgaag

     2941 aacgttttcc aatgatgagc acttttaaag ttctgctatg tggcgcggta ttatcccgta

     3001 ttgacgccgg gcaagagcaa ctcggtcgcc gcatacacta ttctcagaat gacttggttg

     3061 agtactcacc agtcacagaa aagcatctta cggatggcat gacagtaaga gaattatgca

     3121 gtgctgccat aaccatgagt gataacactg cggccaactt acttctgaca acgatcggag

     3181 gaccgaagga gctaaccgct tttttgcaca acatggggga tcatgtaact cgccttgatc

     3241 gttgggaacc ggagctgaat gaagccatac caaacgacga gcgtgacacc acgatgcctg

     3301 tagcaatggc aacaacgttg cgcaaactat taactggcga actacttact ctagcttccc

     3361 ggcaacaatt aatagactgg atggaggcgg ataaagttgc aggaccactt ctgcgctcgg

     3421 cccttccggc tggctggttt attgctgata aatctggagc cggtgagcgt gggtctcgcg

     3481 gtatcattgc agcactgggg ccagatggta agccctcccg tatcgtagtt atctacacga

     3541 cggggagtca ggcaactatg gatgaacgaa atagacagat cgctgagata ggtgcctcac

     3601 tgattaagca ttggtaactg tcagaccaag tttactcata tatactttag attgatttaa

     3661 aacttcattt ttaatttaaa aggatctagg tgaagatcct ttttgataat ctcatgacca

     3721 aaatccctta acgtgagttt tcgttccact gagcgtcaga ccccgtagaa aagatcaaag

     3781 gatcttcttg agatcctttt tttctgcgcg taatctgctg cttgcaaaca aaaaaaccac

     3841 cgctaccagc ggtggtttgt ttgccggatc aagagctacc aactcttttt ccgaaggtaa

     3901 ctggcttcag cagagcgcag ataccaaata ctgtccttct agtgtagccg tagttaggcc

     3961 accacttcaa gaactctgta gcaccgccta catacctcgc tctgctaatc ctgttaccag

     4021 tggctgctgc cagtggcgat aagtcgtgtc ttaccgggtt ggactcaaga cgatagttac

     4081 cggataaggc gcagcggtcg ggctgaacgg ggggttcgtg cacacagccc agcttggagc

     4141 gaacgaccta caccgaactg agatacctac agcgtgagct atgagaaagc gccacgcttc

     4201 ccgaagggag aaaggcggac aggtatccgg taagcggcag ggtcggaaca ggagagcgca

     4261 cgagggagct tccaggggga aacgcctggt atctttatag tcctgtcggg tttcgccacc

     4321 tctgacttga gcgtcgattt ttgtgatgct cgtcaggggg gcggagccta tggaaaaacg

     4381 ccagcaacgc ggccttttta cggttcctgg ccttttgctg gccttttgct cacatgttct

     4441 ttcctgcgtt atcccctgat tctgtggata accgtattac cgcctttgag tgagctgata

     4501 ccgctcgccg cagccgaacg accgagcgca gcgagtcagt gagcgaggaa gcggaagagc

     4561 gcccaatacg caaaccgcct ctccccgcgc gttggccgat tcattaatgc agctgatttc

     4621 actttttgca ttctacaaac tgcataactc atatgtaaat cgctcctttt taggtggcac

     4681 aaatgtgagg cattttcgct ctttccggca accacttcca agtaaagtat aacacactat

     4741 actttatatt cataaagtgt gtgctctgcg aggctgtcgg cagtgccgac caaaaccata

     4801 aaacctttaa gacctttctt ttttttacga gaaaaaagaa acaaaaaaac ctgccctctg

     4861 ccacctcagc aaaggggggt tttgctctcg tgctcgttta aaaatcagca agggacaggt

     4921 agtatttttt gagaagatca ctcaaaaaat ctccaccttt aaacccttgc caatttttat

     4981 tttgtccgtt ttgtctagct taccgaaagc cagactcagc aagaataaaa tttttattgt

     5041 ctttcggttt tctagtgtaa cggacaaaac cactcaaaat aaaaaagata caagagaggt

     5101 ctctcgtatc ttttattcag caatcgcgcc cgattgctga acagattaat aatagatttt

     5161 agctttttat ttgttgaaaa aagctaatca aattgttgtc gggatcaatt actgcaaagt

     5221 ctcgttcatc ccaccactga tcttttaatg atgtattggg gtgcaaaatg cccaaaggct

     5281 taatatgttg atataattca tcaattccct ctacttcaat gcggcaacta gcagtaccag

     5341 caataaacga ctccgcacct gtacaaaccg gtgaatcatt actacgagag cgccagcttc

     5401 atcacttgcc tcccatagat gaatccgaac ctcattacac attagaactg cgaatccatc

     5461 ttcatggtga accaaagtga aacctagttt atcgcaataa aaacctatac tctttttaat

     5521 atccccgact ggcaatgccg ggatagactg taacattctc acgcataaaa tcccctttca

     5581 ttttctaatg taaatctatt accttattat taattcaatt cgctcataat taatcctttt

     5641 tcttattacg caaaatggcc cgatttaagc acacccttta ttccgttaat gcgccatgac

     5701 agccatgata attactaata ctaggagaag ttaataaata cgtaaccaac atgattaaca

     5761 attattagag gtcatcgttc aaaatggtat gcgttttgac acatccacta tatatccgtg

     5821 tcgttctgtc cactcctgaa tcccattcca gaaattctct agcgattcca gaagtttctc

     5881 agagtcggaa agttgaccag acattacgaa ctggcacaga tggtcataac ctgaaggaag

     5941 atctgattgc ttaactgctt cagttaagac cgaagcgctc gtcgtataac agatgcgatg

     6001 atgcagacca atcaacatgg cacctgccat tgctacctgt acagtcaagg atggtagaaa

     6061 tgttgtcggt ccttgcacac gaatattacg ccatttgcct gcatattcaa acagctcttc

     6121 tacgataagg gcacaaatcg catcgtggaa cgtttgggct tctaccgatt tagcagtttg

     6181 atacactttc tctaagtatc cacctgaatc ataaatcggc aaaatagaga aaaattgacc

     6241 atgtgtaagc ggccaatctg attccacctg agatgcataa tctagtagaa tctcttcgct

     6301 atcaaaattc acttccacct tccactcacc ggttgtccat tcatggctga actctgcttc

     6361 ctctgttgac atgacacaca tcatctcaat atccgaatag ggcccatcag tctgacgacc

     6421 aagagagcca taaacaccaa tagccttaac atcatcccca tatttatcca atattcgttc

     6481 cttaatttca tgaacaatct tcattctttc ttctctagtc attattattg gtccattcac

     6541 tattctcatt cccttttcag ataattttag atttgctttt ctaaataaga atatttggag

     6601 agcaccgttc ttattcagct attaataact cgtcttccta agcatccttc aatcctttta

     6661 ataacaatta tagcatctaa tcttcaacaa actggcccgt ttgttgaact actctttaat

     6721 aaaataattt ttccgttccc aattccacat tgcaataata gaaaatccat cttcatcggc

     6781 tttttcgtca tcatctgtat gaatcaaatc gccttcttct gtgtcatcaa ggtttaattt

     6841 tttatgtatt tcttttaaca aaccaccata ggagattaac cttttacggt gtaaaccttc

     6901 ctccaaatca gacaaacgtt tcaaattctt ttcttcatca tcggtcataa aatccgtatc

     6961 ctttacagga tattttgcag tttcgtcaat tgccgattgt atatccgatt tatatttatt

     7021 tttcggtcga atcatttgaa cttttacatt tggatcatag tctaatttca ttgccttttt

     7081 ccaaaattga atccattgtt tttgattcac gtagttttct gtattcttaa aataagttgg

     7141 ttccacacat accaatacat gcatgtgctg attataagaa ttatctttat tatttattgt

     7201 cacttccgtt gcacgcataa aaccaacaag atttttatta atttttttat attgcatcat

     7261 tcggcgaaat ccttgagcca tatctgacaa actcttattt aattcttcgc catcataaac

     7321 atttttaact gttaatgtga gaaacaacca acgaactgtt ggcttttgtt taataacttc

     7381 agcaacaacc ttttgtgact gaatgccatg tttcattgct ctcctccagt tgcacattgg

     7441 acaaagcctg gatttacaaa accacactcg atacaacttt ctttcgcctg tttcacgatt

     7501 ttgtttatac tctaatattt cagcacaatc ttttactctt tcagcctttt taaattcaag

     7561 aatatgcaga agttcaaagt aatcaacatt agcgattttc ttttctctcc atggtctcac

     7621 ttttccactt tttgtcttgt ccactaaaac ccttgatttt tcatctgaat aaatgctact

     7681 attaggacac ataatattaa aagaaacccc cat

//

No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart