pBI101

$260.00

  • Model: PVT11137
  • 50 Units in Stock
Ask a question


Add to Cart:

pBI101


Catalog No. PVT11137
Packing 2ug

 

pBI101 Information

Prokaryotic resistance: Kan

Eukaryotic resistance: G418

Clone strain: stbl3

Culture condition: 37 ℃

Plasmid host: plant

Purpose of plasmid: protein expression

Prokaryotic resistance: kanamycin

 

pBI101 Sequence

LOCUS       Exported               13917 bp ds-DNA     circular SYN 27-SEP-2017

DEFINITION  synthetic circular DNA

ACCESSION   .

VERSION     .

KEYWORDS    .

SOURCE      synthetic DNA construct

  ORGANISM  synthetic DNA construct

REFERENCE   1  (bases 1 to 13917)

  AUTHORS   .

  TITLE     Direct Submission

  JOURNAL   Exported Sep 27, 2017 

FEATURES             Location/Qualifiers

     source          1..13917

                     /organism="synthetic DNA construct"

                     /mol_type="other DNA"

     CDS             complement(145..516)

                     /codon_start=1

                     /gene="traJ"

                     /product="oriT-recognizing protein"

                     /label=traJ

                     /translation="MADETKPTRKGSPPIKVYCLPDERRAIEEKAAAAGMSLSAYLLAV

                     GQGYKITGVVDYEHVRELARINGDLGRLGGLLKLWLTDDPRTARFGDATILALLAKIEE

                     KQDELGKVMMGVVRPRAEP"

     oriT            549..658

                     /note="incP origin of transfer"

     CDS             complement(1339..1989)

                     /codon_start=1

                     /gene="tetR"

                     /product="tetracycline resistance regulatory protein"

                     /label=TetR

                     /translation="MTKLQPNTVIRAALDLLNEVGVDGLTTRKLAERLGVQQPALYWHF

                     RNKRALLDALAEAMLAENHTHSVPRADDDWRSFLIGNARSFRQALLAYRDGARIHAGTR

                     PGAPQMETADAQLRFLCEAGFSAGDAVNALMTISYFTVGAVLEEQAGDSDAGERGGTVE

                     QAPLSPLLRAAIDAFDEAGPDAAFEQGLAVIVDGLAKRRLVVRNVEGPRKGDD"

     misc_feature    2454..2478

                     /label=RB T-DNA repeat

                     /note="right border repeat from nopaline C58 T-DNA"

     promoter        2634..2817

                     /function="NOS promoter"

                     /label=NOS promoter

                     /note="nopaline synthase promoter"

     CDS             2838..3632

                     /codon_start=1

                     /gene="aph(3')-II (or nptII)"

                     /product="aminoglycoside phosphotransferase from Tn5"

                     /label=neo

                     /note="confers resistance to neomycin, kanamycin, and G418 

                     (Geneticin(R))"

                     /translation="MIEQDGLHAGSPAAWVERLFGYDWAQQTIGCSDAAVFRLSAQGRP

                     VLFVKTDLSGALNELQDEAARLSWLATTGVPCAAVLDVVTEAGRDWLLLGEVPGQDLLS

                     SHLAPAEKVSIMADAMRRLHTLDPATCPFDHQAKHRIERARTRMEAGLVDQDDLDEEHQ

                     GLAPAELFARLKARMPDGDDLVVTHGDACLPNIMVENGRFSGFIDCGRLGVADRYQDIA

                     LATRDIAEELGGEWADRFLVLYGIAAPDSQRIAFYRLLDEFF"

     terminator      4022..4274

                     /label=NOS terminator

                     /note="nopaline synthase terminator and poly(A) signal"

     misc_feature    4950..4990

                     /label=MCS

     CDS             5004..6815

                     /codon_start=1

                     /gene="uidA (or gusA) from E. coli"

                     /product="beta-glucuronidase"

                     /label=GUS

                     /translation="MLRPVETPTREIKKLDGLWAFSLDRENCGIDQRWWESALQESRAI

                     AVPGSFNDQFADADIRNYAGNVWYQREVFIPKGWAGQRIVLRFDAVTHYGKVWVNNQEV

                     MEHQGGYTPFEADVTPYVIAGKSVRITVCVNNELNWQTIPPGMVITDENGKKKQSYFHD

                     FFNYAGIHRSVMLYTTPNTWVDDITVVTHVAQDCNHASVDWQVVANGDVSVELRDADQQ

                     VVATGQGTSGTLQVVNPHLWQPGEGYLYELCVTAKSQTECDIYPLRVGIRSVAVKGEQF

                     LINHKPFYFTGFGRHEDADLRGKGFDNVLMVHDHALMDWIGANSYRTSHYPYAEEMLDW

                     ADEHGIVVIDETAAVGFNLSLGIGFEAGNKPKELYSEEAVNGETQQAHLQAIKELIARD

                     KNHPSVVMWSIANEPDTRPQGAREYFAPLAEATRKLDPTRPITCVNVMFCDAHTDTISD

                     LFDVLCLNRYYGWYVQSGDLETAEKVLEKELLAWQEKLHQPIIITEYGVDTLAGLHSMY

                     TDMWSEEYQCAWLDMYHRVFDRVSAVVGEQVWNFADFATSQGILRVGGNKKGIFTRDRK

                     PKSAAFLLQKRWTGMNFGEKPQQGGKQ"

     terminator      6886..7138

                     /label=NOS terminator

                     /note="nopaline synthase terminator and poly(A) signal"

     misc_feature    7781..7805

                     /label=LB T-DNA repeat

                     /note="left border repeat from nopaline C58 T-DNA"

     CDS             complement(9401..10549)

                     /codon_start=1

                     /product="trans-acting replication protein that binds to 

                     and activates oriV"

                     /label=trfA

                     /translation="MNRTFDRKAYRQELIDAGFSAEDAETIASRTVMRAPRETFQSVGS

                     MVQQATAKIERDSVQLAPPALPAPSAAVERSRRLEQEAAGLAKSMTIDTRGTMTTKKRK

                     TAGEDLAKQVSEAKQAALLKHTKQQIKEMQLSLFDIAPWPDTMRAMPNDTARSALFTTR

                     NKKIPREALQNKVIFHVNKDVKITYTGVELRADDDELVWQQVLEYAKRTPIGEPITFTF

                     YELCQDLGWSINGRYYTKAEECLSRLQATAMGFTSDRVGHLESVSLLHRFRVLDRGKKT

                     SRCQVLIDEEIVVLFAGDHYTKFIWEKYRKLSPTARRMFDYFSSHREPYPLKLETFRLM

                     CGSDSTRVKKWREQVGEACEELRGSGLVEHAWVNDDLVHCKR"

     CDS             complement(10848..11642)

                     /codon_start=1

                     /gene="aphA-3"

                     /product="aminoglycoside phosphotransferase"

                     /label=KanR

                     /note="confers resistance to kanamycin"

                     /translation="MAKMRISPELKKLIEKYRCVKDTEGMSPAKVYKLVGENENLYLKM

                     TDSRYKGTTYDVEREKDMMLWLEGKLPVPKVLHFERHDGWSNLLMSEADGVLCSEEYED

                     EQSPEKIIELYAECIRLFHSIDISDCPYTNSLDSRLAELDYLLNNDLADVDCENWEEDT

                     PFKDPRELYDFLKTEKPEEELVFSHGDLGDSNIFVKDGKVSGFIDLGRSGRADKWYDIA

                     FCVRSIREDIGEEQYVELFFDLLGIKPDWEKIKYYILLDELF"

     mobile_element  11834..12601

                     /mobile_element_type="insertion sequence:IS1"

                     /note="prokaryotic transposable element"

     rep_origin      13224..18

                     /label=oriV

                     /note="incP origin of replication"

ORIGIN

        1 tgagcgtcgc aaaggcgctc ggtcttgcct tgctcgtcgg tgatgtactt caccagctcc

       61 gcgaagtcgc tcttcttgat ggagcgcatg gggacgtgct tggcaatcac gcgcaccccc

      121 cggccgtttt agcggctaaa aaagtcatgg ctctgccctc gggcggacca cgcccatcat

      181 gaccttgcca agctcgtcct gcttctcttc gatcttcgcc agcagggcga ggatcgtggc

      241 atcaccgaac cgcgccgtgc gcgggtcgtc ggtgagccag agtttcagca ggccgcccag

      301 gcggcccagg tcgccattga tgcgggccag ctcgcggacg tgctcatagt ccacgacgcc

      361 cgtgattttg tagccctggc cgacggccag caggtaggcc gacaggctca tgccggccgc

      421 cgccgccttt tcctcaatcg ctcttcgttc gtctggaagg cagtacacct tgataggtgg

      481 gctgcccttc ctggttggct tggtttcatc agccatccgc ttgccctcat ctgttacgcc

      541 ggcggtagcc ggccagcctc gcagagcagg attcccgttg agcaccgcca ggtgcgaata

      601 agggacagtg aagaaggaac acccgctcgc gggtgggcct acttcaccta tcctgcccgg

      661 ctgacgccgt tggatacacc aaggaaagtc tacacgaacc ctttggcaaa atcctgtata

      721 tcgtgcgaaa aaggatggat ataccgaaaa aatcgctata atgaccccga agcagggtta

      781 tgcagcggaa aagcgccacg cttcccgaag ggagaaaggc ggacaggtat ccggtaagcg

      841 gcagggtcgg aacaggagag cgcacgaggg agcttccagg gggaaacgcc tggtatcttt

      901 atagtcctgt cgggtttcgc cacctctgac ttgagcgtcg atttttgtga tgctcgtcag

      961 gggggcggag cctatggaaa aacgccagca acgcggcctt tttacggttc ctggcctttt

     1021 gctggccttt tgctcacatg ttctttcctg cgttatcccc tgattctgtg gataaccgta

     1081 ttaccgcctt tgagtgagct gataccgctc gccgcagccg aacgaccgag cgcagcgagt

     1141 cagtgagcga ggaagcggaa gagcgccaga aggccgccag agaggccgag cgcggccgtg

     1201 aggcttggac gctagggcag ggcatgaaaa agcccgtagc gggctgctac gggcgtctga

     1261 cgcggtggaa agggggaggg gatgttgtct acatggctct gctgtagtga gtgggttgcg

     1321 ctccggcagc ggtcctgatc aatcgtcacc ctttctcggt ccttcaacgt tcctgacaac

     1381 gagcctcctt ttcgccaatc catcgacaat caccgcgagt ccctgctcga acgctgcgtc

     1441 cggaccggct tcgtcgaagg cgtctatcgc ggcccgcaac agcggcgaga gcggagcctg

     1501 ttcaacggtg ccgccgcgct cgccggcatc gctgtcgccg gcctgctcct caagcacggc

     1561 cccaacagtg aagtagctga ttgtcatcag cgcattgacg gcgtccccgg ccgaaaaacc

     1621 cgcctcgcag aggaagcgaa gctgcgcgtc ggccgtttcc atctgcggtg cgcccggtcg

     1681 cgtgccggca tggatgcgcg cgccatcgcg gtaggcgagc agcgcctgcc tgaagctgcg

     1741 ggcattcccg atcagaaatg agcgccagtc gtcgtcggct ctcggcaccg aatgcgtatg

     1801 attctccgcc agcatggctt cggccagtgc gtcgagcagc gcccgcttgt tcctgaagtg

     1861 ccagtaaagc gccggctgct gaacccccaa ccgttccgcc agtttgcgtg tcgtcagacc

     1921 gtctacgccg acctcgttca acaggtccag ggcggcacgg atcactgtat tcggctgcaa

     1981 ctttgtcatg cttgacactt tatcactgat aaacataata tgtccaccaa cttatcagtg

     2041 ataaagaatc cgcgcgttca atcggaccag cggaggctgg tccggaggcc agacgtgaaa

     2101 cccaacatac ccctgatcgt aattctgagc actgtcgcgc tcgacgctgt cggcatcggc

     2161 ctgattatgc cggtgctgcc gggcctcctg cgcgatctgg ttcactcgaa cgacgtcacc

     2221 gcccactatg gcattctgct ggcgctgtat gcgttggtgc aatttgcctg cgcacctgtg

     2281 ctgggcgcgc tgtcggatcg tttcgggcgg cggccaatct tgctcgtctc gctggccggc

     2341 gccagatctg gggaaccctg tggttggcat gcacatacaa atggacgaac ggataaacct

     2401 tttcacgccc ttttaaatat ccgattattc taataaacgc tcttttctct taggtttacc

     2461 cgccaatata tcctgtcaaa cactgatagt ttaaactgaa ggcgggaaac gacaatctga

     2521 tcatgagcgg agaattaagg gagtcacgtt atgacccccg ccgatgacgc gggacaagcc

     2581 gttttacgtt tggaactgac agaaccgcaa cgttgaagga gccactcagc cgcgggtttc

     2641 tggagtttaa tgagctaagc acatacgtca gaaaccatta ttgcgcgttc aaaagtcgcc

     2701 taaggtcact atcagctagc aaatatttct tgtcaaaaat gctccactga cgttccataa

     2761 attcccctcg gtatccaatt agagtctcat attcactctc aatccaaata atctgcaccg

     2821 gatctggatc gtttcgcatg attgaacaag atggattgca cgcaggttct ccggccgctt

     2881 gggtggagag gctattcggc tatgactggg cacaacagac aatcggctgc tctgatgccg

     2941 ccgtgttccg gctgtcagcg caggggcgcc cggttctttt tgtcaagacc gacctgtccg

     3001 gtgccctgaa tgaactgcag gacgaggcag cgcggctatc gtggctggcc acgacgggcg

     3061 ttccttgcgc agctgtgctc gacgttgtca ctgaagcggg aagggactgg ctgctattgg

     3121 gcgaagtgcc ggggcaggat ctcctgtcat ctcaccttgc tcctgccgag aaagtatcca

     3181 tcatggctga tgcaatgcgg cggctgcata cgcttgatcc ggctacctgc ccattcgacc

     3241 accaagcgaa acatcgcatc gagcgagcac gtactcggat ggaagccggt cttgtcgatc

     3301 aggatgatct ggacgaagag catcaggggc tcgcgccagc cgaactgttc gccaggctca

     3361 aggcgcgcat gcccgacggc gatgatctcg tcgtgaccca tggcgatgcc tgcttgccga

     3421 atatcatggt ggaaaatggc cgcttttctg gattcatcga ctgtggccgg ctgggtgtgg

     3481 cggaccgcta tcaggacata gcgttggcta cccgtgatat tgctgaagag cttggcggcg

     3541 aatgggctga ccgcttcctc gtgctttacg gtatcgccgc tcccgattcg cagcgcatcg

     3601 ccttctatcg ccttcttgac gagttcttct gagcgggact ctggggttcg aaatgaccga

     3661 ccaagcgacg cccaacctgc catcacgaga tttcgattcc accgccgcct tctatgaaag

     3721 gttgggcttc ggaatcgttt tccgggacgc cggctggatg atcctccagc gcggggatct

     3781 catgctggag ttcttcgccc acgggatctc tgcggaacag gcggtcgaag gtgccgatat

     3841 cattacgaca gcaacggccg acaagcacaa cgccacgatc ctgagcgaca atatgatcgg

     3901 gcccggcgtc cacatcaacg gcgtcggcgg cgactgccca ggcaagaccg agatgcaccg

     3961 cgatatcttg ctgcgttcgg atattttcgt ggagttcccg ccacagaccc ggatgatccc

     4021 cgatcgttca aacatttggc aataaagttt cttaagattg aatcctgttg ccggtcttgc

     4081 gatgattatc atataatttc tgttgaatta cgttaagcat gtaataatta acatgtaatg

     4141 catgacgtta tttatgagat gggtttttat gattagagtc ccgcaattat acatttaata

     4201 cgcgatagaa aacaaaatat agcgcgcaaa ctaggataaa ttatcgcgcg cggtgtcatc

     4261 tatgttacta gatcgggcct cctgtcaatg ctggcggcgg ctctggtggt ggttctggtg

     4321 gcggctctga gggtggtggc tctgagggtg gcggttctga gggtggcggc tctgagggag

     4381 gcggttccgg tggtggctct ggttccggtg attttgatta tgaaaagatg gcaaacgcta

     4441 ataagggggc tatgaccgaa aatgccgatg aaaacgcgct acagtctgac gctaaaggca

     4501 aacttgattc tgtcgctact gattacggtg ctgctatcga tggtttcatt ggtgacgttt

     4561 ccggccttgc taatggtaat ggtgctactg gtgattttgc tggctctaat tcccaaatgg

     4621 ctcaagtcgg tgacggtgat aattcacctt taatgaataa tttccgtcaa tatttacctt

     4681 ccctccctca atcggttgaa tgtcgccctt ttgtctttgg cccaatacgc aaaccgcctc

     4741 tccccgcgcg ttggccgatt cattaatgca gctggcacga caggtttccc gactggaaag

     4801 cgggcagtga gcgcaacgca attaatgtga gttagctcac tcattaggca ccccaggctt

     4861 tacactttat gcttccggct cgtatgttgt gtggaattgt gagcggataa caatttcaca

     4921 caggaaacag ctatgaccat gattacgcca agcttgcatg cctgcaggtc gactctagag

     4981 gatccccggg tggtcagtcc cttatgttac gtcctgtaga aaccccaacc cgtgaaatca

     5041 aaaaactcga cggcctgtgg gcattcagtc tggatcgcga aaactgtgga attgatcagc

     5101 gttggtggga aagcgcgtta caagaaagcc gggcaattgc tgtgccaggc agttttaacg

     5161 atcagttcgc cgatgcagat attcgtaatt atgcgggcaa cgtctggtat cagcgcgaag

     5221 tctttatacc gaaaggttgg gcaggccagc gtatcgtgct gcgtttcgat gcggtcactc

     5281 attacggcaa agtgtgggtc aataatcagg aagtgatgga gcatcagggc ggctatacgc

     5341 catttgaagc cgatgtcacg ccgtatgtta ttgccgggaa aagtgtacgt atcaccgttt

     5401 gtgtgaacaa cgaactgaac tggcagacta tcccgccggg aatggtgatt accgacgaaa

     5461 acggcaagaa aaagcagtct tacttccatg atttctttaa ctatgccgga atccatcgca

     5521 gcgtaatgct ctacaccacg ccgaacacct gggtggacga tatcaccgtg gtgacgcatg

     5581 tcgcgcaaga ctgtaaccac gcgtctgttg actggcaggt ggtggccaat ggtgatgtca

     5641 gcgttgaact gcgtgatgcg gatcaacagg tggttgcaac tggacaaggc actagcggga

     5701 ctttgcaagt ggtgaatccg cacctctggc aaccgggtga aggttatctc tatgaactgt

     5761 gcgtcacagc caaaagccag acagagtgtg atatctaccc gcttcgcgtc ggcatccggt

     5821 cagtggcagt gaagggcgaa cagttcctga ttaaccacaa accgttctac tttactggct

     5881 ttggtcgtca tgaagatgcg gacttgcgtg gcaaaggatt cgataacgtg ctgatggtgc

     5941 acgaccacgc attaatggac tggattgggg ccaactccta ccgtacctcg cattaccctt

     6001 acgctgaaga gatgctcgac tgggcagatg aacatggcat cgtggtgatt gatgaaactg

     6061 ctgctgtcgg ctttaacctc tctttaggca ttggtttcga agcgggcaac aagccgaaag

     6121 aactgtacag cgaagaggca gtcaacgggg aaactcagca agcgcactta caggcgatta

     6181 aagagctgat agcgcgtgac aaaaaccacc caagcgtggt gatgtggagt attgccaacg

     6241 aaccggatac ccgtccgcaa ggtgcacggg aatatttcgc gccactggcg gaagcaacgc

     6301 gtaaactcga cccgacgcgt ccgatcacct gcgtcaatgt aatgttctgc gacgctcaca

     6361 ccgataccat cagcgatctc tttgatgtgc tgtgcctgaa ccgttattac ggatggtatg

     6421 tccaaagcgg cgatttggaa acggcagaga aggtactgga aaaagaactt ctggcctggc

     6481 aggagaaact gcatcagccg attatcatca ccgaatacgg cgtggatacg ttagccgggc

     6541 tgcactcaat gtacaccgac atgtggagtg aagagtatca gtgtgcatgg ctggatatgt

     6601 atcaccgcgt ctttgatcgc gtcagcgccg tcgtcggtga acaggtatgg aatttcgccg

     6661 attttgcgac ctcgcaaggc atattgcgcg ttggcggtaa caagaaaggg atcttcactc

     6721 gcgaccgcaa accgaagtcg gcggcttttc tgctgcaaaa acgctggact ggcatgaact

     6781 tcggtgaaaa accgcagcag ggaggcaaac aatgaatcaa caactctcct ggcgcaccat

     6841 cgtcggctac agcctcggga attgctaccg agctcgaatt tccccgatcg ttcaaacatt

     6901 tggcaataaa gtttcttaag attgaatcct gttgccggtc ttgcgatgat tatcatataa

     6961 tttctgttga attacgttaa gcatgtaata attaacatgt aatgcatgac gttatttatg

     7021 agatgggttt ttatgattag agtcccgcaa ttatacattt aatacgcgat agaaaacaaa

     7081 atatagcgcg caaactagga taaattatcg cgcgcggtgt catctatgtt actagatcgg

     7141 gaattcactg gccgtcgttt tacaacgtcg tgactgggaa aaccctggcg ttacccaact

     7201 taatcgcctt gcagcacatc cccctttcgc cagctggcgt aatagcgaag aggcccgcac

     7261 cgatcgccct tcccaacagt tgcgcagcct gaatggcgcc cgctcctttc gctttcttcc

     7321 cttcctttct cgccacgttc gccggctttc cccgtcaagc tctaaatcgg gggctccctt

     7381 tagggttccg atttagtgct ttacggcacc tcgaccccaa aaaacttgat ttgggtgatg

     7441 gttcacgtag tgggccatcg ccctgataga cggtttttcg ccctttgacg ttggagtcca

     7501 cgttctttaa tagtggactc ttgttccaaa ctggaacaac actcaaccct atctcgggct

     7561 attcttttga tttataaggg attttgccga tttcggaacc accatcaaac aggattttcg

     7621 cctgctgggg caaaccagcg tggaccgctt gctgcaactc tctcagggcc aggcggtgaa

     7681 gggcaatcag ctgttgcccg tctcactggt gaaaagaaaa accaccccag tacattaaaa

     7741 acgtccgcaa tgtgttatta agttgtctaa gcgtcaattt gtttacacca caatatatcc

     7801 tgccaccagc cagccaacag ctccccgacc ggcagctcgg cacaaaatca ccactcgata

     7861 caggcagccc atcagtccgg gacggcgtca gcgggagagc cgttgtaagg cggcagactt

     7921 tgctcatgtt accgatgcta ttcggaagaa cggcaactaa gctgccgggt ttgaaacacg

     7981 gatgatctcg cggagggtag catgttgatt gtaacgatga cagagcgttg ctgcctgtga

     8041 tcaaatatca tctccctcgc agagatccga attatcagcc ttcttattca tttctcgctt

     8101 aaccgtgaca ggctgtcgat cttgagaact atgccgacat aataggaaat cgctggataa

     8161 agccgctgag gaagctgagt ggcgctattt ctttagaagt gaacgttgac gatatcaact

     8221 cccctatcca ttgctcaccg aatggtacag gtcggggacc cgaagttccg actgtcggcc

     8281 tgatgcatcc ccggctgatc gaccccagat ctggggctga gaaagcccag taaggaaaca

     8341 actgtaggtt cgagtcgcga gatcccccgg aaccaaagga agtaggttaa acccgctccg

     8401 atcaggccga gccacgccag gccgagaaca ttggttcctg taggcatcgg gattggcgga

     8461 tcaaacacta aagctactgg aacgagcaga agtcctccgg ccgccagttg ccaggcggta

     8521 aaggtgagca gaggcacggg aggttgccac ttgcgggtca gcacggttcc gaacgccatg

     8581 gaaaccgccc ccgccaggcc cgctgcgacg ccgacaggat ctagcgctgc gtttggtgtc

     8641 aacaccaaca gcgccacgcc cgcagttccg caaatagccc ccaggaccgc catcaatcgt

     8701 atcgggctac ctagcagagc ggcagagatg aacacgacca tcagcggctg cacagcgcct

     8761 accgtcgccg cgaccccgcc cggcaggcgg tagaccgaaa taaacaacaa gctccagaat

     8821 agcgaaatat taagtgcgcc gaggatgaag atgcgcatcc accagattcc cgttggaatc

     8881 tgtcggacga tcatcacgag caataaaccc gccggcaacg cccgcagcag cataccggcg

     8941 acccctcggc ctcgctgttc gggctccacg aaaacgccgg acagatgcgc cttgtgagcg

     9001 tccttggggc cgtcctcctg tttgaagacc gacagcccaa tgatctcgcc gtcgatgtag

     9061 gcgccgaatg ccacggcatc tcgcaaccgt tcagcgaacg cctccatggg ctttttctcc

     9121 tcgtgctcgt aaacggaccc gaacatctct ggagctttct tcagggccga caatcggatc

     9181 tcgcggaaat cctgcacgtc ggccgctcca agccgtcgaa tctgagcctt aatcacaatt

     9241 gtcaatttta atcctctgtt tatcggcagt tcgtagagcg cgccgtgcgt cccgagcgat

     9301 actgagcgaa gcaagtgcgt cgagcagtgc ccgcttgttc ctgaaatgcc agtaaagcgc

     9361 tggctgctga acccccagcc ggaactgacc ccacaaggcc ctagcgtttg caatgcacca

     9421 ggtcatcatt gacccaggcg tgttccacca ggccgctgcc tcgcaactct tcgcaggctt

     9481 cgccgacctg ctcgcgccac ttcttcacgc gggtggaatc cgatccgcac atgaggcgga

     9541 aggtttccag cttgagcggg tacggctccc ggtgcgagct gaaatagtcg aacatccgtc

     9601 gggccgtcgg cgacagcttg cggtacttct cccatatgaa tttcgtgtag tggtcgccag

     9661 caaacagcac gacgatttcc tcgtcgatca ggacctggca acgggacgtt ttcttgccac

     9721 ggtccaggac gcggaagcgg tgcagcagcg acaccgattc caggtgccca acgcggtcgg

     9781 acgtgaagcc catcgccgtc gcctgtaggc gcgacaggca ttcctcggcc ttcgtgtaat

     9841 accggccatt gatcgaccag cccaggtcct ggcaaagctc gtagaacgtg aaggtgatcg

     9901 gctcgccgat aggggtgcgc ttcgcgtact ccaacacctg ctgccacacc agttcgtcat

     9961 cgtcggcccg cagctcgacg ccggtgtagg tgatcttcac gtccttgttg acgtggaaaa

    10021 tgaccttgtt ttgcagcgcc tcgcgcggga ttttcttgtt gcgcgtggtg aacagggcag

    10081 agcgggccgt gtcgtttggc atcgctcgca tcgtgtccgg ccacggcgca atatcgaaca

    10141 aggaaagctg catttccttg atctgctgct tcgtgtgttt cagcaacgcg gcctgcttgg

    10201 cctcgctgac ctgttttgcc aggtcctcgc cggcggtttt tcgcttcttg gtcgtcatag

    10261 ttcctcgcgt gtcgatggtc atcgacttcg ccaaacctgc cgcctcctgt tcgagacgac

    10321 gcgaacgctc cacggcggcc gatggcgcgg gcagggcagg gggagccagt tgcacgctgt

    10381 cgcgctcgat cttggccgta gcttgctgga ccatcgagcc gacggactgg aaggtttcgc

    10441 ggggcgcacg catgacggtg cggcttgcga tggtttcggc atcctcggcg gaaaaccccg

    10501 cgtcgatcag ttcttgcctg tatgccttcc ggtcaaacgt ccgattcatt caccctcctt

    10561 gcgggattgc cccgactcac gccggggcaa tgtgccctta ttcctgattt gacccgcctg

    10621 gtgccttggt gtccagataa tccaccttat cggcaatgaa gtcggtcccg tagaccgtct

    10681 ggccgtcctt ctcgtacttg gtattccgaa tcttgccctg cacgaatacc agcgacccct

    10741 tgcccaaata cttgccgtgg gcctcggcct gagagccaaa acacttgatg cggaagaagt

    10801 cggtgcgctc ctgcttgtcg ccggcatcgt tgcgccacat ctaggtacta aaacaattca

    10861 tccagtaaaa tataatattt tattttctcc caatcaggct tgatccccag taagtcaaaa

    10921 aatagctcga catactgttc ttccccgata tcctccctga tcgaccggac gcagaaggca

    10981 atgtcatacc acttgtccgc cctgccgctt ctcccaagat caataaagcc acttactttg

    11041 ccatctttca caaagatgtt gctgtctccc aggtcgccgt gggaaaagac aagttcctct

    11101 tcgggctttt ccgtctttaa aaaatcatac agctcgcgcg gatctttaaa tggagtgtct

    11161 tcttcccagt tttcgcaatc cacatcggcc agatcgttat tcagtaagta atccaattcg

    11221 gctaagcggc tgtctaagct attcgtatag ggacaatccg atatgtcgat ggagtgaaag

    11281 agcctgatgc actccgcata cagctcgata atcttttcag ggctttgttc atcttcatac

    11341 tcttccgagc aaaggacgcc atcggcctca ctcatgagca gattgctcca gccatcatgc

    11401 cgttcaaagt gcaggacctt tggaacaggc agctttcctt ccagccatag catcatgtcc

    11461 ttttcccgtt ccacatcata ggtggtccct ttataccggc tgtccgtcat ttttaaatat

    11521 aggttttcat tttctcccac cagcttatat accttagcag gagacattcc ttccgtatct

    11581 tttacgcagc ggtatttttc gatcagtttt ttcaattccg gtgatattct cattttagcc

    11641 atttattatt tccttcctct tttctacagt atttaaagat accccaagaa gctaattata

    11701 acaagacgaa ctccaattca ctgttccttg cattctaaaa ccttaaatac cagaaaacag

    11761 ctttttcaaa gttgttttca aagttggcgt ataacatagt atcgacggag ccgattttga

    11821 aaccacaatt atgggtgatg ctgccaactt actgatttag tgtatgatgg tgtttttgag

    11881 gtgctccagt ggcttctgtg tctatcagct gtccctcctg ttcagctact gacggggtgg

    11941 tgcgtaacgg caaaagcacc gccggacatc agcgctatct ctgctctcac tgccgtaaaa

    12001 catggcaact gcagttcact tacaccgctt ctcaacccgg tacgcaccag aaaatcattg

    12061 atatggccat gaatggcgtt ggatgccggg caacagcccg cattatgggc gttggcctca

    12121 acacgatttt acgtcactta aaaaactcag gccgcagtcg gtaacctcgc gcatacagcc

    12181 gggcagtgac gtcatcgtct gcgcggaaat ggacgaacag tggggctatg tcggggctaa

    12241 atcgcgccag cgctggctgt tttacgcgta tgacagtctc cggaagacgg ttgttgcgca

    12301 cgtattcggt gaacgcacta tggcgacgct ggggcgtctt atgagcctgc tgtcaccctt

    12361 tgacgtggtg atatggatga cggatggctg gccgctgtat gaatcccgcc tgaagggaaa

    12421 gctgcacgta atcagcaagc gatatacgca gcgaattgag cggcataacc tgaatctgag

    12481 gcagcacctg gcacggctgg gacggaagtc gctgtcgttc tcaaaatcgg tggagctgca

    12541 tgacaaagtc atcgggcatt atctgaacat aaaacactat caataagttg gagtcattac

    12601 ccaattatga tagaatttac aagctataag gttattgtcc tgggtttcaa gcattagtcc

    12661 atgcaagttt ttatgctttg cccattctat agatatattg ataagcgcgc tgcctatgcc

    12721 ttgccccctg aaatccttac atacggcgat atcttctata taaaagatat attatcttat

    12781 cagtattgtc aatatattca aggcaatctg cctcctcatc ctcttcatcc tcttcgtctt

    12841 ggtagctttt taaatatggc gcttcataga gtaattctgt aaaggtccaa ttctcgtttt

    12901 catacctcgg tataatctta cctatcacct caaatggttc gctgggttta tcgcaccccc

    12961 gaacacgagc acggcacccg cgaccactat gccaagaatg cccaaggtaa aaattgccgg

    13021 ccccgccatg aagtccgtga atgccccgac ggccgaagtg aagggcaggc cgccacccag

    13081 gccgccgccc tcactgcccg gcacctggtc gctgaatgtc gatgccagca cctgcggcac

    13141 gtcaatgctt ccgggcgtcg cgctcgggct gatcgcccat cccgttactg ccccgatccc

    13201 ggcaatggca aggactgcca gcgctgccat ttttggggtg aggccgttcg cggccgaggg

    13261 gcgcagcccc tggggggatg ggaggcccgc gttagcgggc cgggagggtt cgagaagggg

    13321 gggcaccccc cttcggcgtg cgcggtcacg cgcacagggc gcagccctgg ttaaaaacaa

    13381 ggtttataaa tattggttta aaagcaggtt aaaagacagg ttagcggtgg ccgaaaaacg

    13441 ggcggaaacc cttgcaaatg ctggattttc tgcctgtgga cagcccctca aatgtcaata

    13501 ggtgcgcccc tcatctgtca gcactctgcc cctcaagtgt caaggatcgc gcccctcatc

    13561 tgtcagtagt cgcgcccctc aagtgtcaat accgcagggc acttatcccc aggcttgtcc

    13621 acatcatctg tgggaaactc gcgtaaaatc aggcgttttc gccgatttgc gaggctggcc

    13681 agctccacgt cgccggccga aatcgagcct gcccctcatc tgtcaacgcc gcgccgggtg

    13741 agtcggcccc tcaagtgtca acgtccgccc ctcatctgtc agtgagggcc aagttttccg

    13801 cgaggtatcc acaacgccgg cggccgcggt gtctcgcaca cggcttcgac ggcgtttctg

    13861 gcgcgtttgc agggccatag acggccgcca gcccagcggc gagggcaacc agcccgg

//

Caution:
Product is for research use only!

No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart