pBI121- EGFP- 2

$260.00

  • Model: PVT11140
  • 50 Units in Stock
Ask a question


Add to Cart:

pBI121-EGFP-2

Catalog No. PVT11140
Packing 2ug

Function plant expression plasmid

Promoter: 35S

Prokaryotic resistance: Kan

Eukaryotic resistance: G418

Clone strain: stbl3

Culture condition: 37 ℃

 

pBI121-EGFP-2 Sequence

LOCUS       Exported               13629 bp ds-DNA     circular SYN 27-SEP-2017

DEFINITION  synthetic circular DNA

ACCESSION   .

VERSION     .

KEYWORDS    .

SOURCE      synthetic DNA construct

  ORGANISM  synthetic DNA construct

REFERENCE   1  (bases 1 to 13629)

  AUTHORS   .

  TITLE     Direct Submission

  JOURNAL   Exported Sep 27, 2017

FEATURES             Location/Qualifiers

     source          1..13629

                     /organism="synthetic DNA construct"

                     /mol_type="other DNA"

     CDS             complement(145..516)

                     /codon_start=1

                     /gene="traJ"

                     /product="oriT-recognizing protein"

                     /label=traJ

                     /translation="MADETKPTRKGSPPIKVYCLPDERRAIEEKAAAAGMSLSAYLLAV

                     GQGYKITGVVDYEHVRELARINGDLGRLGGLLKLWLTDDPRTARFGDATILALLAKIEE

                     KQDELGKVMMGVVRPRAEP"

     oriT            549..658

                     /note="incP origin of transfer"

     CDS             complement(1339..1989)

                     /codon_start=1

                     /gene="tetR"

                     /product="tetracycline resistance regulatory protein"

                     /label=TetR

                     /translation="MTKLQPNTVIRAALDLLNEVGVDGLTTRKLAERLGVQQPALYWHF

                     RNKRALLDALAEAMLAENHTHSVPRADDDWRSFLIGNARSFRQALLAYRDGARIHAGTR

                     PGAPQMETADAQLRFLCEAGFSAGDAVNALMTISYFTVGAVLEEQAGDSDAGERGGTVE

                     QAPLSPLLRAAIDAFDEAGPDAAFEQGLAVIVDGLAKRRLVVRNVEGPRKGDD"

     misc_feature    2454..2478

                     /label=RB T-DNA repeat

                     /note="right border repeat from nopaline C58 T-DNA"

     promoter        2602..2817

                     /label=NOS promoter

                     /note="nopaline synthase promoter"

     CDS             2838..3632

                     /codon_start=1

                     /gene="aph(3')-II (or nptII)"

                     /product="aminoglycoside phosphotransferase from Tn5"

                     /label=Neo

                     /note="confers resistance to neomycin, kanamycin, and G418 

                     (Geneticin(R))"

                     /translation="MIEQDGLHAGSPAAWVERLFGYDWAQQTIGCSDAAVFRLSAQGRP

                     VLFVKTDLSGALNELQDEAARLSWLATTGVPCAAVLDVVTEAGRDWLLLGEVPGQDLLS

                     SHLAPAEKVSIMADAMRRLHTLDPATCPFDHQAKHRIERARTRMEAGLVDQDDLDEEHQ

                     GLAPAELFARLKARMPDGDDLVVTHGDACLPNIMVENGRFSGFIDCGRLGVADRYQDIA

                     LATRDIAEELGGEWADRFLVLYGIAAPDSQRIAFYRLLDEFF"

     terminator      4022..4274

                     /label=NOS terminator

                     /note="nopaline synthase terminator and poly(A) signal"

     promoter        5461..5806

                     /label=CaMV 35S promoter

                     /note="strong constitutive promoter from cauliflower mosaic

                     virus"

     CDS             5838..6554

                     /codon_start=1

                     /product="enhanced GFP"

                     /label=EGFP

                     /note="mammalian codon-optimized"

                     /translation="MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTL

                     KFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDD

                     GNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIK

                     VNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLL

                     EFVTAAGITLGMDELYK"

     CDS             6561..6578

                     /codon_start=1

                     /product="6xHis affinity tag"

                     /label=6xHis

                     /translation="HHHHHH"

     terminator      6598..6850

                     /label=NOS terminator

                     /note="nopaline synthase terminator and poly(A) signal"

     misc_feature    7493..7517

                     /label=LB T-DNA repeat

                     /note="left border repeat from nopaline C58 T-DNA"

     CDS             complement(9113..10261)

                     /codon_start=1

                     /product="trans-acting replication protein that binds to 

                     and activates oriV"

                     /label=trfA

                     /translation="MNRTFDRKAYRQELIDAGFSAEDAETIASRTVMRAPRETFQSVGS

                     MVQQATAKIERDSVQLAPPALPAPSAAVERSRRLEQEAAGLAKSMTIDTRGTMTTKKRK

                     TAGEDLAKQVSEAKQAALLKHTKQQIKEMQLSLFDIAPWPDTMRAMPNDTARSALFTTR

                     NKKIPREALQNKVIFHVNKDVKITYTGVELRADDDELVWQQVLEYAKRTPIGEPITFTF

                     YELCQDLGWSINGRYYTKAEECLSRLQATAMGFTSDRVGHLESVSLLHRFRVLDRGKKT

                     SRCQVLIDEEIVVLFAGDHYTKFIWEKYRKLSPTARRMFDYFSSHREPYPLKLETFRLM

                     CGSDSTRVKKWREQVGEACEELRGSGLVEHAWVNDDLVHCKR"

     CDS             complement(10560..11354)

                     /codon_start=1

                     /gene="aphA-3"

                     /product="aminoglycoside phosphotransferase"

                     /label=KanR

                     /note="confers resistance to kanamycin"

                     /translation="MAKMRISPELKKLIEKYRCVKDTEGMSPAKVYKLVGENENLYLKM

                     TDSRYKGTTYDVEREKDMMLWLEGKLPVPKVLHFERHDGWSNLLMSEADGVLCSEEYED

                     EQSPEKIIELYAECIRLFHSIDISDCPYTNSLDSRLAELDYLLNNDLADVDCENWEEDT

                     PFKDPRELYDFLKTEKPEEELVFSHGDLGDSNIFVKDGKVSGFIDLGRSGRADKWYDIA

                     FCVRSIREDIGEEQYVELFFDLLGIKPDWEKIKYYILLDELF"

     mobile_element  11546..12313

                     /mobile_element_type="insertion sequence:IS1"

                     /note="prokaryotic transposable element"

     rep_origin      12936..18

                     /label=oriV

                     /note="incP origin of replication"

ORIGIN

        1 tgagcgtcgc aaaggcgctc ggtcttgcct tgctcgtcgg tgatgtactt caccagctcc

       61 gcgaagtcgc tcttcttgat ggagcgcatg gggacgtgct tggcaatcac gcgcaccccc

      121 cggccgtttt agcggctaaa aaagtcatgg ctctgccctc gggcggacca cgcccatcat

      181 gaccttgcca agctcgtcct gcttctcttc gatcttcgcc agcagggcga ggatcgtggc

      241 atcaccgaac cgcgccgtgc gcgggtcgtc ggtgagccag agtttcagca ggccgcccag

      301 gcggcccagg tcgccattga tgcgggccag ctcgcggacg tgctcatagt ccacgacgcc

      361 cgtgattttg tagccctggc cgacggccag caggtaggcc gacaggctca tgccggccgc

      421 cgccgccttt tcctcaatcg ctcttcgttc gtctggaagg cagtacacct tgataggtgg

      481 gctgcccttc ctggttggct tggtttcatc agccatccgc ttgccctcat ctgttacgcc

      541 ggcggtagcc ggccagcctc gcagagcagg attcccgttg agcaccgcca ggtgcgaata

      601 agggacagtg aagaaggaac acccgctcgc gggtgggcct acttcaccta tcctgcccgg

      661 ctgacgccgt tggatacacc aaggaaagtc tacacgaacc ctttggcaaa atcctgtata

      721 tcgtgcgaaa aaggatggat ataccgaaaa aatcgctata atgaccccga agcagggtta

      781 tgcagcggaa aagcgccacg cttcccgaag ggagaaaggc ggacaggtat ccggtaagcg

      841 gcagggtcgg aacaggagag cgcacgaggg agcttccagg gggaaacgcc tggtatcttt

      901 atagtcctgt cgggtttcgc cacctctgac ttgagcgtcg atttttgtga tgctcgtcag

      961 gggggcggag cctatggaaa aacgccagca acgcggcctt tttacggttc ctggcctttt

     1021 gctggccttt tgctcacatg ttctttcctg cgttatcccc tgattctgtg gataaccgta

     1081 ttaccgcctt tgagtgagct gataccgctc gccgcagccg aacgaccgag cgcagcgagt

     1141 cagtgagcga ggaagcggaa gagcgccaga aggccgccag agaggccgag cgcggccgtg

     1201 aggcttggac gctagggcag ggcatgaaaa agcccgtagc gggctgctac gggcgtctga

     1261 cgcggtggaa agggggaggg gatgttgtct acatggctct gctgtagtga gtgggttgcg

     1321 ctccggcagc ggtcctgatc aatcgtcacc ctttctcggt ccttcaacgt tcctgacaac

     1381 gagcctcctt ttcgccaatc catcgacaat caccgcgagt ccctgctcga acgctgcgtc

     1441 cggaccggct tcgtcgaagg cgtctatcgc ggcccgcaac agcggcgaga gcggagcctg

     1501 ttcaacggtg ccgccgcgct cgccggcatc gctgtcgccg gcctgctcct caagcacggc

     1561 cccaacagtg aagtagctga ttgtcatcag cgcattgacg gcgtccccgg ccgaaaaacc

     1621 cgcctcgcag aggaagcgaa gctgcgcgtc ggccgtttcc atctgcggtg cgcccggtcg

     1681 cgtgccggca tggatgcgcg cgccatcgcg gtaggcgagc agcgcctgcc tgaagctgcg

     1741 ggcattcccg atcagaaatg agcgccagtc gtcgtcggct ctcggcaccg aatgcgtatg

     1801 attctccgcc agcatggctt cggccagtgc gtcgagcagc gcccgcttgt tcctgaagtg

     1861 ccagtaaagc gccggctgct gaacccccaa ccgttccgcc agtttgcgtg tcgtcagacc

     1921 gtctacgccg acctcgttca acaggtccag ggcggcacgg atcactgtat tcggctgcaa

     1981 ctttgtcatg cttgacactt tatcactgat aaacataata tgtccaccaa cttatcagtg

     2041 ataaagaatc cgcgcgttca atcggaccag cggaggctgg tccggaggcc agacgtgaaa

     2101 cccaacatac ccctgatcgt aattctgagc actgtcgcgc tcgacgctgt cggcatcggc

     2161 ctgattatgc cggtgctgcc gggcctcctg cgcgatctgg ttcactcgaa cgacgtcacc

     2221 gcccactatg gcattctgct ggcgctgtat gcgttggtgc aatttgcctg cgcacctgtg

     2281 ctgggcgcgc tgtcggatcg tttcgggcgg cggccaatct tgctcgtctc gctggccggc

     2341 gccagatctg gggaaccctg tggttggcat gcacatacaa atggacgaac ggataaacct

     2401 tttcacgccc ttttaaatat ccgattattc taataaacgc tcttttctct taggtttacc

     2461 cgccaatata tcctgtcaaa cactgatagt ttaaactgaa ggcgggaaac gacaatctga

     2521 tcatgagcgg agaattaagg gagtcacgtt atgacccccg ccgatgacgc gggacaagcc

     2581 gttttacgtt tggaactgac agaaccgcaa cgttgaagga gccactcagc cgcgggtttc

     2641 tggagtttaa tgagctaagc acatacgtca gaaaccatta ttgcgcgttc aaaagtcgcc

     2701 taaggtcact atcagctagc aaatatttct tgtcaaaaat gctccactga cgttccataa

     2761 attcccctcg gtatccaatt agagtctcat attcactctc aatccaaata atctgcaccg

     2821 gatctggatc gtttcgcatg attgaacaag atggattgca cgcaggttct ccggccgctt

     2881 gggtggagag gctattcggc tatgactggg cacaacagac aatcggctgc tctgatgccg

     2941 ccgtgttccg gctgtcagcg caggggcgcc cggttctttt tgtcaagacc gacctgtccg

     3001 gtgccctgaa tgaactgcag gacgaggcag cgcggctatc gtggctggcc acgacgggcg

     3061 ttccttgcgc agctgtgctc gacgttgtca ctgaagcggg aagggactgg ctgctattgg

     3121 gcgaagtgcc ggggcaggat ctcctgtcat ctcaccttgc tcctgccgag aaagtatcca

     3181 tcatggctga tgcaatgcgg cggctgcata cgcttgatcc ggctacctgc ccattcgacc

     3241 accaagcgaa acatcgcatc gagcgagcac gtactcggat ggaagccggt cttgtcgatc

     3301 aggatgatct ggacgaagag catcaggggc tcgcgccagc cgaactgttc gccaggctca

     3361 aggcgcgcat gcccgacggc gatgatctcg tcgtgaccca tggcgatgcc tgcttgccga

     3421 atatcatggt ggaaaatggc cgcttttctg gattcatcga ctgtggccgg ctgggtgtgg

     3481 cggaccgcta tcaggacata gcgttggcta cccgtgatat tgctgaagag cttggcggcg

     3541 aatgggctga ccgcttcctc gtgctttacg gtatcgccgc tcccgattcg cagcgcatcg

     3601 ccttctatcg ccttcttgac gagttcttct gagcgggact ctggggttcg aaatgaccga

     3661 ccaagcgacg cccaacctgc catcacgaga tttcgattcc accgccgcct tctatgaaag

     3721 gttgggcttc ggaatcgttt tccgggacgc cggctggatg atcctccagc gcggggatct

     3781 catgctggag ttcttcgccc acgggatctc tgcggaacag gcggtcgaag gtgccgatat

     3841 cattacgaca gcaacggccg acaagcacaa cgccacgatc ctgagcgaca atatgatcgg

     3901 gcccggcgtc cacatcaacg gcgtcggcgg cgactgccca ggcaagaccg agatgcaccg

     3961 cgatatcttg ctgcgttcgg atattttcgt ggagttcccg ccacagaccc ggatgatccc

     4021 cgatcgttca aacatttggc aataaagttt cttaagattg aatcctgttg ccggtcttgc

     4081 gatgattatc atataatttc tgttgaatta cgttaagcat gtaataatta acatgtaatg

     4141 catgacgtta tttatgagat gggtttttat gattagagtc ccgcaattat acatttaata

     4201 cgcgatagaa aacaaaatat agcgcgcaaa ctaggataaa ttatcgcgcg cggtgtcatc

     4261 tatgttacta gatcgggcct cctgtcaatg ctggcggcgg ctctggtggt ggttctggtg

     4321 gcggctctga gggtggtggc tctgagggtg gcggttctga gggtggcggc tctgagggag

     4381 gcggttccgg tggtggctct ggttccggtg attttgatta tgaaaagatg gcaaacgcta

     4441 ataagggggc tatgaccgaa aatgccgatg aaaacgcgct acagtctgac gctaaaggca

     4501 aacttgattc tgtcgctact gattacggtg ctgctatcga tggtttcatt ggtgacgttt

     4561 ccggccttgc taatggtaat ggtgctactg gtgattttgc tggctctaat tcccaaatgg

     4621 ctcaagtcgg tgacggtgat aattcacctt taatgaataa tttccgtcaa tatttacctt

     4681 ccctccctca atcggttgaa tgtcgccctt ttgtctttgg cccaatacgc aaaccgcctc

     4741 tccccgcgcg ttggccgatt cattaatgca gctggcacga caggtttccc gactggaaag

     4801 cgggcagtga gcgcaacgca attaatgtga gttagctcac tcattaggca ccccaggctt

     4861 tacactttat gcttccggct cgtatgttgt gtggaattgt gagcggataa caatttcaca

     4921 caggaaacag ctatgaccat gattacgcca agcttgcatg cctgcaggtc cccagattag

     4981 ccttttcaat ttcagaaaga atgctaaccc acagatggtt agagaggctt acgcagcagg

     5041 tctcatcaag acgatctacc cgagcaataa tctccaggaa atcaaatacc ttcccaagaa

     5101 ggttaaagat gcagtcaaaa gattcaggac taactgcatc aagaacacag agaaagatat

     5161 atttctcaag atcagaagta ctattccagt atggacgatt caaggcttgc ttcacaaacc

     5221 aaggcaagta atagagattg gagtctctaa aaaggtagtt cccactgaat caaaggccat

     5281 ggagtcaaag attcaaatag aggacctaac agaactcgcc gtaaagactg gcgaacagtt

     5341 catacagagt ctcttacgac tcaatgacaa gaagaaaatc ttcgtcaaca tggtggagca

     5401 cgacacactt gtctactcca aaaatatcaa agatacagtc tcagaagacc aaagggcaat

     5461 tgagactttt caacaaaggg taatatccgg aaacctcctc ggattccatt gcccagctat

     5521 ctgtcacttt attgtgaaga tagtggaaaa ggaaggtggc tcctacaaat gccatcattg

     5581 cgataaagga aaggccatcg ttgaagatgc ctctgccgac agtggtccca aagatggacc

     5641 cccacccacg aggagcatcg tggaaaaaga agacgttcca accacgtctt caaagcaagt

     5701 ggattgatgt gatatctcca ctgacgtaag ggatgacgca caatcccact atccttcgca

     5761 agacccttcc tctatataag gaagttcatt tcatttggag agaacacggg ggactctaga

     5821 ggatccccgg gggtaccatg gtgagcaagg gcgaggagct gttcaccggg gtggtgccca

     5881 tcctggtcga gctggacggc gacgtaaacg gccacaagtt cagcgtgtcc ggcgagggcg

     5941 agggcgatgc cacctacggc aagctgaccc tgaagttcat ctgcaccacc ggcaagctgc

     6001 ccgtgccctg gcccaccctc gtgaccaccc tgacctacgg cgtgcagtgc ttcagccgct

     6061 accccgacca catgaagcag cacgacttct tcaagtccgc catgcccgaa ggctacgtcc

     6121 aggagcgcac catcttcttc aaggacgacg gcaactacaa gacccgcgcc gaggtgaagt

     6181 tcgagggcga caccctggtg aaccgcatcg agctgaaggg catcgacttc aaggaggacg

     6241 gcaacatcct ggggcacaag ctggagtaca actacaacag ccacaacgtc tatatcatgg

     6301 ccgacaagca gaagaacggc atcaaggtga acttcaagat ccgccacaac atcgaggacg

     6361 gcagcgtgca gctcgccgac cactaccagc agaacacccc catcggcgac ggccccgtgc

     6421 tgctgcccga caaccactac ctgagcaccc agtccgccct gagcaaagac cccaacgaga

     6481 agcgcgatca catggtcctg ctggagttcg tgaccgccgc cgggatcact ctcggcatgg

     6541 acgagctgta caagctcgag caccaccacc accaccactg agagctcgaa tttccccgat

     6601 cgttcaaaca tttggcaata aagtttctta agattgaatc ctgttgccgg tcttgcgatg

     6661 attatcatat aatttctgtt gaattacgtt aagcatgtaa taattaacat gtaatgcatg

     6721 acgttattta tgagatgggt ttttatgatt agagtcccgc aattatacat ttaatacgcg

     6781 atagaaaaca aaatatagcg cgcaaactag gataaattat cgcgcgcggt gtcatctatg

     6841 ttactagatc gggaattcac tggccgtcgt tttacaacgt cgtgactggg aaaaccctgg

     6901 cgttacccaa cttaatcgcc ttgcagcaca tccccctttc gccagctggc gtaatagcga

     6961 agaggcccgc accgatcgcc cttcccaaca gttgcgcagc ctgaatggcg cccgctcctt

     7021 tcgctttctt cccttccttt ctcgccacgt tcgccggctt tccccgtcaa gctctaaatc

     7081 gggggctccc tttagggttc cgatttagtg ctttacggca cctcgacccc aaaaaacttg

     7141 atttgggtga tggttcacgt agtgggccat cgccctgata gacggttttt cgccctttga

     7201 cgttggagtc cacgttcttt aatagtggac tcttgttcca aactggaaca acactcaacc

     7261 ctatctcggg ctattctttt gatttataag ggattttgcc gatttcggaa ccaccatcaa

     7321 acaggatttt cgcctgctgg ggcaaaccag cgtggaccgc ttgctgcaac tctctcaggg

     7381 ccaggcggtg aagggcaatc agctgttgcc cgtctcactg gtgaaaagaa aaaccacccc

     7441 agtacattaa aaacgtccgc aatgtgttat taagttgtct aagcgtcaat ttgtttacac

     7501 cacaatatat cctgccacca gccagccaac agctccccga ccggcagctc ggcacaaaat

     7561 caccactcga tacaggcagc ccatcagtcc gggacggcgt cagcgggaga gccgttgtaa

     7621 ggcggcagac tttgctcatg ttaccgatgc tattcggaag aacggcaact aagctgccgg

     7681 gtttgaaaca cggatgatct cgcggagggt agcatgttga ttgtaacgat gacagagcgt

     7741 tgctgcctgt gatcaaatat catctccctc gcagagatcc gaattatcag ccttcttatt

     7801 catttctcgc ttaaccgtga caggctgtcg atcttgagaa ctatgccgac ataataggaa

     7861 atcgctggat aaagccgctg aggaagctga gtggcgctat ttctttagaa gtgaacgttg

     7921 acgatatcaa ctcccctatc cattgctcac cgaatggtac aggtcgggga cccgaagttc

     7981 cgactgtcgg cctgatgcat ccccggctga tcgaccccag atctggggct gagaaagccc

     8041 agtaaggaaa caactgtagg ttcgagtcgc gagatccccc ggaaccaaag gaagtaggtt

     8101 aaacccgctc cgatcaggcc gagccacgcc aggccgagaa cattggttcc tgtaggcatc

     8161 gggattggcg gatcaaacac taaagctact ggaacgagca gaagtcctcc ggccgccagt

     8221 tgccaggcgg taaaggtgag cagaggcacg ggaggttgcc acttgcgggt cagcacggtt

     8281 ccgaacgcca tggaaaccgc ccccgccagg cccgctgcga cgccgacagg atctagcgct

     8341 gcgtttggtg tcaacaccaa cagcgccacg cccgcagttc cgcaaatagc ccccaggacc

     8401 gccatcaatc gtatcgggct acctagcaga gcggcagaga tgaacacgac catcagcggc

     8461 tgcacagcgc ctaccgtcgc cgcgaccccg cccggcaggc ggtagaccga aataaacaac

     8521 aagctccaga atagcgaaat attaagtgcg ccgaggatga agatgcgcat ccaccagatt

     8581 cccgttggaa tctgtcggac gatcatcacg agcaataaac ccgccggcaa cgcccgcagc

     8641 agcataccgg cgacccctcg gcctcgctgt tcgggctcca cgaaaacgcc ggacagatgc

     8701 gccttgtgag cgtccttggg gccgtcctcc tgtttgaaga ccgacagccc aatgatctcg

     8761 ccgtcgatgt aggcgccgaa tgccacggca tctcgcaacc gttcagcgaa cgcctccatg

     8821 ggctttttct cctcgtgctc gtaaacggac ccgaacatct ctggagcttt cttcagggcc

     8881 gacaatcgga tctcgcggaa atcctgcacg tcggccgctc caagccgtcg aatctgagcc

     8941 ttaatcacaa ttgtcaattt taatcctctg tttatcggca gttcgtagag cgcgccgtgc

     9001 gtcccgagcg atactgagcg aagcaagtgc gtcgagcagt gcccgcttgt tcctgaaatg

     9061 ccagtaaagc gctggctgct gaacccccag ccggaactga ccccacaagg ccctagcgtt

     9121 tgcaatgcac caggtcatca ttgacccagg cgtgttccac caggccgctg cctcgcaact

     9181 cttcgcaggc ttcgccgacc tgctcgcgcc acttcttcac gcgggtggaa tccgatccgc

     9241 acatgaggcg gaaggtttcc agcttgagcg ggtacggctc ccggtgcgag ctgaaatagt

     9301 cgaacatccg tcgggccgtc ggcgacagct tgcggtactt ctcccatatg aatttcgtgt

     9361 agtggtcgcc agcaaacagc acgacgattt cctcgtcgat caggacctgg caacgggacg

     9421 ttttcttgcc acggtccagg acgcggaagc ggtgcagcag cgacaccgat tccaggtgcc

     9481 caacgcggtc ggacgtgaag cccatcgccg tcgcctgtag gcgcgacagg cattcctcgg

     9541 ccttcgtgta ataccggcca ttgatcgacc agcccaggtc ctggcaaagc tcgtagaacg

     9601 tgaaggtgat cggctcgccg ataggggtgc gcttcgcgta ctccaacacc tgctgccaca

     9661 ccagttcgtc atcgtcggcc cgcagctcga cgccggtgta ggtgatcttc acgtccttgt

     9721 tgacgtggaa aatgaccttg ttttgcagcg cctcgcgcgg gattttcttg ttgcgcgtgg

     9781 tgaacagggc agagcgggcc gtgtcgtttg gcatcgctcg catcgtgtcc ggccacggcg

     9841 caatatcgaa caaggaaagc tgcatttcct tgatctgctg cttcgtgtgt ttcagcaacg

     9901 cggcctgctt ggcctcgctg acctgttttg ccaggtcctc gccggcggtt tttcgcttct

     9961 tggtcgtcat agttcctcgc gtgtcgatgg tcatcgactt cgccaaacct gccgcctcct

    10021 gttcgagacg acgcgaacgc tccacggcgg ccgatggcgc gggcagggca gggggagcca

    10081 gttgcacgct gtcgcgctcg atcttggccg tagcttgctg gaccatcgag ccgacggact

    10141 ggaaggtttc gcggggcgca cgcatgacgg tgcggcttgc gatggtttcg gcatcctcgg

    10201 cggaaaaccc cgcgtcgatc agttcttgcc tgtatgcctt ccggtcaaac gtccgattca

    10261 ttcaccctcc ttgcgggatt gccccgactc acgccggggc aatgtgccct tattcctgat

    10321 ttgacccgcc tggtgccttg gtgtccagat aatccacctt atcggcaatg aagtcggtcc

    10381 cgtagaccgt ctggccgtcc ttctcgtact tggtattccg aatcttgccc tgcacgaata

    10441 ccagcgaccc cttgcccaaa tacttgccgt gggcctcggc ctgagagcca aaacacttga

    10501 tgcggaagaa gtcggtgcgc tcctgcttgt cgccggcatc gttgcgccac atctaggtac

    10561 taaaacaatt catccagtaa aatataatat tttattttct cccaatcagg cttgatcccc

    10621 agtaagtcaa aaaatagctc gacatactgt tcttccccga tatcctccct gatcgaccgg

    10681 acgcagaagg caatgtcata ccacttgtcc gccctgccgc ttctcccaag atcaataaag

    10741 ccacttactt tgccatcttt cacaaagatg ttgctgtctc ccaggtcgcc gtgggaaaag

    10801 acaagttcct cttcgggctt ttccgtcttt aaaaaatcat acagctcgcg cggatcttta

    10861 aatggagtgt cttcttccca gttttcgcaa tccacatcgg ccagatcgtt attcagtaag

    10921 taatccaatt cggctaagcg gctgtctaag ctattcgtat agggacaatc cgatatgtcg

    10981 atggagtgaa agagcctgat gcactccgca tacagctcga taatcttttc agggctttgt

    11041 tcatcttcat actcttccga gcaaaggacg ccatcggcct cactcatgag cagattgctc

    11101 cagccatcat gccgttcaaa gtgcaggacc tttggaacag gcagctttcc ttccagccat

    11161 agcatcatgt ccttttcccg ttccacatca taggtggtcc ctttataccg gctgtccgtc

    11221 atttttaaat ataggttttc attttctccc accagcttat ataccttagc aggagacatt

    11281 ccttccgtat cttttacgca gcggtatttt tcgatcagtt ttttcaattc cggtgatatt

    11341 ctcattttag ccatttatta tttccttcct cttttctaca gtatttaaag ataccccaag

    11401 aagctaatta taacaagacg aactccaatt cactgttcct tgcattctaa aaccttaaat

    11461 accagaaaac agctttttca aagttgtttt caaagttggc gtataacata gtatcgacgg

    11521 agccgatttt gaaaccacaa ttatgggtga tgctgccaac ttactgattt agtgtatgat

    11581 ggtgtttttg aggtgctcca gtggcttctg tgtctatcag ctgtccctcc tgttcagcta

    11641 ctgacggggt ggtgcgtaac ggcaaaagca ccgccggaca tcagcgctat ctctgctctc

    11701 actgccgtaa aacatggcaa ctgcagttca cttacaccgc ttctcaaccc ggtacgcacc

    11761 agaaaatcat tgatatggcc atgaatggcg ttggatgccg ggcaacagcc cgcattatgg

    11821 gcgttggcct caacacgatt ttacgtcact taaaaaactc aggccgcagt cggtaacctc

    11881 gcgcatacag ccgggcagtg acgtcatcgt ctgcgcggaa atggacgaac agtggggcta

    11941 tgtcggggct aaatcgcgcc agcgctggct gttttacgcg tatgacagtc tccggaagac

    12001 ggttgttgcg cacgtattcg gtgaacgcac tatggcgacg ctggggcgtc ttatgagcct

    12061 gctgtcaccc tttgacgtgg tgatatggat gacggatggc tggccgctgt atgaatcccg

    12121 cctgaaggga aagctgcacg taatcagcaa gcgatatacg cagcgaattg agcggcataa

    12181 cctgaatctg aggcagcacc tggcacggct gggacggaag tcgctgtcgt tctcaaaatc

    12241 ggtggagctg catgacaaag tcatcgggca ttatctgaac ataaaacact atcaataagt

    12301 tggagtcatt acccaattat gatagaattt acaagctata aggttattgt cctgggtttc

    12361 aagcattagt ccatgcaagt ttttatgctt tgcccattct atagatatat tgataagcgc

    12421 gctgcctatg ccttgccccc tgaaatcctt acatacggcg atatcttcta tataaaagat

    12481 atattatctt atcagtattg tcaatatatt caaggcaatc tgcctcctca tcctcttcat

    12541 cctcttcgtc ttggtagctt tttaaatatg gcgcttcata gagtaattct gtaaaggtcc

    12601 aattctcgtt ttcatacctc ggtataatct tacctatcac ctcaaatggt tcgctgggtt

    12661 tatcgcaccc ccgaacacga gcacggcacc cgcgaccact atgccaagaa tgcccaaggt

    12721 aaaaattgcc ggccccgcca tgaagtccgt gaatgccccg acggccgaag tgaagggcag

    12781 gccgccaccc aggccgccgc cctcactgcc cggcacctgg tcgctgaatg tcgatgccag

    12841 cacctgcggc acgtcaatgc ttccgggcgt cgcgctcggg ctgatcgccc atcccgttac

    12901 tgccccgatc ccggcaatgg caaggactgc cagcgctgcc atttttgggg tgaggccgtt

    12961 cgcggccgag gggcgcagcc cctgggggga tgggaggccc gcgttagcgg gccgggaggg

    13021 ttcgagaagg gggggcaccc cccttcggcg tgcgcggtca cgcgcacagg gcgcagccct

    13081 ggttaaaaac aaggtttata aatattggtt taaaagcagg ttaaaagaca ggttagcggt

    13141 ggccgaaaaa cgggcggaaa cccttgcaaa tgctggattt tctgcctgtg gacagcccct

    13201 caaatgtcaa taggtgcgcc cctcatctgt cagcactctg cccctcaagt gtcaaggatc

    13261 gcgcccctca tctgtcagta gtcgcgcccc tcaagtgtca ataccgcagg gcacttatcc

    13321 ccaggcttgt ccacatcatc tgtgggaaac tcgcgtaaaa tcaggcgttt tcgccgattt

    13381 gcgaggctgg ccagctccac gtcgccggcc gaaatcgagc ctgcccctca tctgtcaacg

    13441 ccgcgccggg tgagtcggcc cctcaagtgt caacgtccgc ccctcatctg tcagtgaggg

    13501 ccaagttttc cgcgaggtat ccacaacgcc ggcggccgcg gtgtctcgca cacggcttcg

    13561 acggcgtttc tggcgcgttt gcagggccat agacggccgc cagcccagcg gcgagggcaa

    13621 ccagcccgg

//

 

Caution:
Product is for research use only!

No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart