pBI121- mCherry Plasmid

$136.00

  • Model: PVT3005
  • 50 Units in Stock
Ask a question


Add to Cart:

pBI121-mCherry

PVT3005

 

pBI121-mCherry Information

Promoter: CaMV 35S

Reproducer: oriV

Terminator: NOS

Plasmid Classification: Plant Series, Protein Overexpression

Plasmid size: 13603 BP

Prokaryotic resistance: Kan

Screening Marker: Neo

Cloning strain: DH5alpha

Culture conditions: 37 C, aerobic LB

5'Sequencing Primers: 35S: GACGCAATCCCACTATCC

3'Sequencing Primers: Designing Primers Based on Sequences

Use: Plant expression

 

pBI121-mCherry Site

pBI121-mCherry-Plasmid

 

pBI121-mCherry Sequence

LOCUS       Exported               13603 bp ds-DNA     circular SYN 31-DEC-2012

DEFINITION  synthetic circular DNA

ACCESSION   .

VERSION     .

KEYWORDS    

SOURCE      synthetic DNA construct

  ORGANISM  synthetic DNA construct

REFERENCE   1  (bases 1 to 13603)

  AUTHORS   .

  TITLE     Direct Submission

  JOURNAL   Exported Tuesday, September 13, 2016 from SnapGene Viewer 3.2.1

FEATURES             Location/Qualifiers

     source          1..13603

                     /organism="synthetic DNA construct"

                     /mol_type="other DNA"

     CDS             complement(145..516)

                     /codon_start=1

                     /gene="traJ"

                     /product="oriT-recognizing protein"

                     /note="traJ"

                     /translation="MADETKPTRKGSPPIKVYCLPDERRAIEEKAAAAGMSLSAYLLAV

                     GQGYKITGVVDYEHVRELARINGDLGRLGGLLKLWLTDDPRTARFGDATILALLAKIEE

                     KQDELGKVMMGVVRPRAEP"

     oriT            549..658

                     /note="incP origin of transfer"

     CDS             complement(1339..1989)

                     /codon_start=1

                     /gene="tetR"

                     /product="tetracycline resistance regulatory protein"

                     /note="TetR"

                     /translation="MTKLQPNTVIRAALDLLNEVGVDGLTTRKLAERLGVQQPALYWHF

                     RNKRALLDALAEAMLAENHTHSVPRADDDWRSFLIGNARSFRQALLAYRDGARIHAGTR

                     PGAPQMETADAQLRFLCEAGFSAGDAVNALMTISYFTVGAVLEEQAGDSDAGERGGTVE

                     QAPLSPLLRAAIDAFDEAGPDAAFEQGLAVIVDGLAKRRLVVRNVEGPRKGDD"

     misc_feature    2454..2478

                     /note="RB T-DNA repeat"

                     /note="right border repeat from nopaline C58 T-DNA"

     promoter        2602..2781

                     /note="NOS promoter"

                     /note="nopaline synthase promoter"

     promoter        2634..2817

                     /function="NOS promoter"

                     /note="NOS promoter"

                     /note="nopaline synthase promoter"

     CDS             2838..3632

                     /codon_start=1

                     /gene="aph(3')-II (or nptII)"

                     /product="aminoglycoside phosphotransferase from Tn5"

                     /note="NeoR/KanR"

                     /note="confers resistance to neomycin, kanamycin, and G418 

                     (Geneticin(R))"

                     /translation="MIEQDGLHAGSPAAWVERLFGYDWAQQTIGCSDAAVFRLSAQGRP

                     VLFVKTDLSGALNELQDEAARLSWLATTGVPCAAVLDVVTEAGRDWLLLGEVPGQDLLS

                     SHLAPAEKVSIMADAMRRLHTLDPATCPFDHQAKHRIERARTRMEAGLVDQDDLDEEHQ

                     GLAPAELFARLKARMPDGDDLVVTHGDACLPNIMVENGRFSGFIDCGRLGVADRYQDIA

                     LATRDIAEELGGEWADRFLVLYGIAAPDSQRIAFYRLLDEFF"

     terminator      4022..4274

                     /note="NOS terminator"

                     /note="nopaline synthase terminator and poly(A) signal"

     protein_bind    4823..4844

                     /bound_moiety="E. coli catabolite activator protein"

                     /note="CAP binding site"

                     /note="CAP binding activates transcription in the presence 

                     of cAMP."

     promoter        4859..4889

                     /note="lac promoter"

                     /note="promoter for the E. coli lac operon"

     protein_bind    4897..4913

                     /bound_moiety="lac repressor encoded by lacI"

                     /note="lac operator"

                     /note="The lac repressor binds to the lac operator to 

                     inhibit transcription in E. coli. This inhibition can be 

                     relieved by adding lactose or 

                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."

     primer_bind     4921..4937

                     /note="M13 rev"

                     /note="common sequencing primer, one of multiple similar 

                     variants"

     promoter        5461..5806

                     /note="CaMV 35S promoter"

                     /note="strong constitutive promoter from cauliflower mosaic

                     virus"

     CDS             5845..6555

                     /codon_start=1

                     /product="monomeric derivative of DsRed fluorescent protein

                     (Shaner et al., 2004)"

                     /note="mCherry"

                     /note="mammalian codon-optimized"

                     /translation="MVSKGEEDNMAIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEG

                     TQTAKLKVTKGGPLPFAWDILSPQFMYGSKAYVKHPADIPDYLKLSFPEGFKWERVMNF

                     EDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASSERMYPEDGALK

                     GEIKQRLKLKDGGHYDAEVKTTYKAKKPVQLPGAYNVNIKLDITSHNEDYTIVEQYERA

                     EGRHSTGGMDELYK"

     terminator      6572..6824

                     /note="NOS terminator"

                     /note="nopaline synthase terminator and poly(A) signal"

     primer_bind     complement(6833..6849)

                     /note="M13 fwd"

                     /note="common sequencing primer, one of multiple similar 

                     variants"

     misc_feature    7467..7491

                     /note="LB T-DNA repeat"

                     /note="left border repeat from nopaline C58 T-DNA"

     CDS             complement(9087..10235)

                     /codon_start=1

                     /product="trans-acting replication protein that binds to 

                     and activates oriV"

                     /note="trfA"

                     /translation="MNRTFDRKAYRQELIDAGFSAEDAETIASRTVMRAPRETFQSVGS

                     MVQQATAKIERDSVQLAPPALPAPSAAVERSRRLEQEAAGLAKSMTIDTRGTMTTKKRK

                     TAGEDLAKQVSEAKQAALLKHTKQQIKEMQLSLFDIAPWPDTMRAMPNDTARSALFTTR

                     NKKIPREALQNKVIFHVNKDVKITYTGVELRADDDELVWQQVLEYAKRTPIGEPITFTF

                     YELCQDLGWSINGRYYTKAEECLSRLQATAMGFTSDRVGHLESVSLLHRFRVLDRGKKT

                     SRCQVLIDEEIVVLFAGDHYTKFIWEKYRKLSPTARRMFDYFSSHREPYPLKLETFRLM

                     CGSDSTRVKKWREQVGEACEELRGSGLVEHAWVNDDLVHCKR"

     CDS             complement(10534..11328)

                     /codon_start=1

                     /gene="aphA-3"

                     /product="aminoglycoside phosphotransferase"

                     /note="KanR"

                     /note="confers resistance to kanamycin"

                     /translation="MAKMRISPELKKLIEKYRCVKDTEGMSPAKVYKLVGENENLYLKM

                     TDSRYKGTTYDVEREKDMMLWLEGKLPVPKVLHFERHDGWSNLLMSEADGVLCSEEYED

                     EQSPEKIIELYAECIRLFHSIDISDCPYTNSLDSRLAELDYLLNNDLADVDCENWEEDT

                     PFKDPRELYDFLKTEKPEEELVFSHGDLGDSNIFVKDGKVSGFIDLGRSGRADKWYDIA

                     FCVRSIREDIGEEQYVELFFDLLGIKPDWEKIKYYILLDELF"

     mobile_element  11520..12287

                     /mobile_element_type="insertion sequence:IS1"

                     /note="IS1"

                     /note="prokaryotic transposable element"

     rep_origin      12910..18

                     /note="oriV"

                     /note="incP origin of replication"

ORIGIN

        1 tgagcgtcgc aaaggcgctc ggtcttgcct tgctcgtcgg tgatgtactt caccagctcc

       61 gcgaagtcgc tcttcttgat ggagcgcatg gggacgtgct tggcaatcac gcgcaccccc

      121 cggccgtttt agcggctaaa aaagtcatgg ctctgccctc gggcggacca cgcccatcat

      181 gaccttgcca agctcgtcct gcttctcttc gatcttcgcc agcagggcga ggatcgtggc

      241 atcaccgaac cgcgccgtgc gcgggtcgtc ggtgagccag agtttcagca ggccgcccag

      301 gcggcccagg tcgccattga tgcgggccag ctcgcggacg tgctcatagt ccacgacgcc

      361 cgtgattttg tagccctggc cgacggccag caggtaggcc gacaggctca tgccggccgc

      421 cgccgccttt tcctcaatcg ctcttcgttc gtctggaagg cagtacacct tgataggtgg

      481 gctgcccttc ctggttggct tggtttcatc agccatccgc ttgccctcat ctgttacgcc

      541 ggcggtagcc ggccagcctc gcagagcagg attcccgttg agcaccgcca ggtgcgaata

      601 agggacagtg aagaaggaac acccgctcgc gggtgggcct acttcaccta tcctgcccgg

      661 ctgacgccgt tggatacacc aaggaaagtc tacacgaacc ctttggcaaa atcctgtata

      721 tcgtgcgaaa aaggatggat ataccgaaaa aatcgctata atgaccccga agcagggtta

      781 tgcagcggaa aagcgccacg cttcccgaag ggagaaaggc ggacaggtat ccggtaagcg

      841 gcagggtcgg aacaggagag cgcacgaggg agcttccagg gggaaacgcc tggtatcttt

      901 atagtcctgt cgggtttcgc cacctctgac ttgagcgtcg atttttgtga tgctcgtcag

      961 gggggcggag cctatggaaa aacgccagca acgcggcctt tttacggttc ctggcctttt

     1021 gctggccttt tgctcacatg ttctttcctg cgttatcccc tgattctgtg gataaccgta

     1081 ttaccgcctt tgagtgagct gataccgctc gccgcagccg aacgaccgag cgcagcgagt

     1141 cagtgagcga ggaagcggaa gagcgccaga aggccgccag agaggccgag cgcggccgtg

     1201 aggcttggac gctagggcag ggcatgaaaa agcccgtagc gggctgctac gggcgtctga

     1261 cgcggtggaa agggggaggg gatgttgtct acatggctct gctgtagtga gtgggttgcg

     1321 ctccggcagc ggtcctgatc aatcgtcacc ctttctcggt ccttcaacgt tcctgacaac

     1381 gagcctcctt ttcgccaatc catcgacaat caccgcgagt ccctgctcga acgctgcgtc

     1441 cggaccggct tcgtcgaagg cgtctatcgc ggcccgcaac agcggcgaga gcggagcctg

     1501 ttcaacggtg ccgccgcgct cgccggcatc gctgtcgccg gcctgctcct caagcacggc

     1561 cccaacagtg aagtagctga ttgtcatcag cgcattgacg gcgtccccgg ccgaaaaacc

     1621 cgcctcgcag aggaagcgaa gctgcgcgtc ggccgtttcc atctgcggtg cgcccggtcg

     1681 cgtgccggca tggatgcgcg cgccatcgcg gtaggcgagc agcgcctgcc tgaagctgcg

     1741 ggcattcccg atcagaaatg agcgccagtc gtcgtcggct ctcggcaccg aatgcgtatg

     1801 attctccgcc agcatggctt cggccagtgc gtcgagcagc gcccgcttgt tcctgaagtg

     1861 ccagtaaagc gccggctgct gaacccccaa ccgttccgcc agtttgcgtg tcgtcagacc

     1921 gtctacgccg acctcgttca acaggtccag ggcggcacgg atcactgtat tcggctgcaa

     1981 ctttgtcatg cttgacactt tatcactgat aaacataata tgtccaccaa cttatcagtg

     2041 ataaagaatc cgcgcgttca atcggaccag cggaggctgg tccggaggcc agacgtgaaa

     2101 cccaacatac ccctgatcgt aattctgagc actgtcgcgc tcgacgctgt cggcatcggc

     2161 ctgattatgc cggtgctgcc gggcctcctg cgcgatctgg ttcactcgaa cgacgtcacc

     2221 gcccactatg gcattctgct ggcgctgtat gcgttggtgc aatttgcctg cgcacctgtg

     2281 ctgggcgcgc tgtcggatcg tttcgggcgg cggccaatct tgctcgtctc gctggccggc

     2341 gccagatctg gggaaccctg tggttggcat gcacatacaa atggacgaac ggataaacct

     2401 tttcacgccc ttttaaatat ccgattattc taataaacgc tcttttctct taggtttacc

     2461 cgccaatata tcctgtcaaa cactgatagt ttaaactgaa ggcgggaaac gacaatctga

     2521 tcatgagcgg agaattaagg gagtcacgtt atgacccccg ccgatgacgc gggacaagcc

     2581 gttttacgtt tggaactgac agaaccgcaa cgttgaagga gccactcagc cgcgggtttc

     2641 tggagtttaa tgagctaagc acatacgtca gaaaccatta ttgcgcgttc aaaagtcgcc

     2701 taaggtcact atcagctagc aaatatttct tgtcaaaaat gctccactga cgttccataa

     2761 attcccctcg gtatccaatt agagtctcat attcactctc aatccaaata atctgcaccg

     2821 gatctggatc gtttcgcatg attgaacaag atggattgca cgcaggttct ccggccgctt

     2881 gggtggagag gctattcggc tatgactggg cacaacagac aatcggctgc tctgatgccg

     2941 ccgtgttccg gctgtcagcg caggggcgcc cggttctttt tgtcaagacc gacctgtccg

     3001 gtgccctgaa tgaactgcag gacgaggcag cgcggctatc gtggctggcc acgacgggcg

     3061 ttccttgcgc agctgtgctc gacgttgtca ctgaagcggg aagggactgg ctgctattgg

     3121 gcgaagtgcc ggggcaggat ctcctgtcat ctcaccttgc tcctgccgag aaagtatcca

     3181 tcatggctga tgcaatgcgg cggctgcata cgcttgatcc ggctacctgc ccattcgacc

     3241 accaagcgaa acatcgcatc gagcgagcac gtactcggat ggaagccggt cttgtcgatc

     3301 aggatgatct ggacgaagag catcaggggc tcgcgccagc cgaactgttc gccaggctca

     3361 aggcgcgcat gcccgacggc gatgatctcg tcgtgaccca tggcgatgcc tgcttgccga

     3421 atatcatggt ggaaaatggc cgcttttctg gattcatcga ctgtggccgg ctgggtgtgg

     3481 cggaccgcta tcaggacata gcgttggcta cccgtgatat tgctgaagag cttggcggcg

     3541 aatgggctga ccgcttcctc gtgctttacg gtatcgccgc tcccgattcg cagcgcatcg

     3601 ccttctatcg ccttcttgac gagttcttct gagcgggact ctggggttcg aaatgaccga

     3661 ccaagcgacg cccaacctgc catcacgaga tttcgattcc accgccgcct tctatgaaag

     3721 gttgggcttc ggaatcgttt tccgggacgc cggctggatg atcctccagc gcggggatct

     3781 catgctggag ttcttcgccc acgggatctc tgcggaacag gcggtcgaag gtgccgatat

     3841 cattacgaca gcaacggccg acaagcacaa cgccacgatc ctgagcgaca atatgatcgg

     3901 gcccggcgtc cacatcaacg gcgtcggcgg cgactgccca ggcaagaccg agatgcaccg

     3961 cgatatcttg ctgcgttcgg atattttcgt ggagttcccg ccacagaccc ggatgatccc

     4021 cgatcgttca aacatttggc aataaagttt cttaagattg aatcctgttg ccggtcttgc

     4081 gatgattatc atataatttc tgttgaatta cgttaagcat gtaataatta acatgtaatg

     4141 catgacgtta tttatgagat gggtttttat gattagagtc ccgcaattat acatttaata

     4201 cgcgatagaa aacaaaatat agcgcgcaaa ctaggataaa ttatcgcgcg cggtgtcatc

     4261 tatgttacta gatcgggcct cctgtcaatg ctggcggcgg ctctggtggt ggttctggtg

     4321 gcggctctga gggtggtggc tctgagggtg gcggttctga gggtggcggc tctgagggag

     4381 gcggttccgg tggtggctct ggttccggtg attttgatta tgaaaagatg gcaaacgcta

     4441 ataagggggc tatgaccgaa aatgccgatg aaaacgcgct acagtctgac gctaaaggca

     4501 aacttgattc tgtcgctact gattacggtg ctgctatcga tggtttcatt ggtgacgttt

     4561 ccggccttgc taatggtaat ggtgctactg gtgattttgc tggctctaat tcccaaatgg

     4621 ctcaagtcgg tgacggtgat aattcacctt taatgaataa tttccgtcaa tatttacctt

     4681 ccctccctca atcggttgaa tgtcgccctt ttgtctttgg cccaatacgc aaaccgcctc

     4741 tccccgcgcg ttggccgatt cattaatgca gctggcacga caggtttccc gactggaaag

     4801 cgggcagtga gcgcaacgca attaatgtga gttagctcac tcattaggca ccccaggctt

     4861 tacactttat gcttccggct cgtatgttgt gtggaattgt gagcggataa caatttcaca

     4921 caggaaacag ctatgaccat gattacgcca agcttgcatg cctgcaggtc cccagattag

     4981 ccttttcaat ttcagaaaga atgctaaccc acagatggtt agagaggctt acgcagcagg

     5041 tctcatcaag acgatctacc cgagcaataa tctccaggaa atcaaatacc ttcccaagaa

     5101 ggttaaagat gcagtcaaaa gattcaggac taactgcatc aagaacacag agaaagatat

     5161 atttctcaag atcagaagta ctattccagt atggacgatt caaggcttgc ttcacaaacc

     5221 aaggcaagta atagagattg gagtctctaa aaaggtagtt cccactgaat caaaggccat

     5281 ggagtcaaag attcaaatag aggacctaac agaactcgcc gtaaagactg gcgaacagtt

     5341 catacagagt ctcttacgac tcaatgacaa gaagaaaatc ttcgtcaaca tggtggagca

     5401 cgacacactt gtctactcca aaaatatcaa agatacagtc tcagaagacc aaagggcaat

     5461 tgagactttt caacaaaggg taatatccgg aaacctcctc ggattccatt gcccagctat

     5521 ctgtcacttt attgtgaaga tagtggaaaa ggaaggtggc tcctacaaat gccatcattg

     5581 cgataaagga aaggccatcg ttgaagatgc ctctgccgac agtggtccca aagatggacc

     5641 cccacccacg aggagcatcg tggaaaaaga agacgttcca accacgtctt caaagcaagt

     5701 ggattgatgt gatatctcca ctgacgtaag ggatgacgca caatcccact atccttcgca

     5761 agacccttcc tctatataag gaagttcatt tcatttggag agaacacggg ggactctaga

     5821 ggatccccgg gtggtcagtc ccttatggtg agcaagggcg aggaggataa catggccatc

     5881 atcaaggagt tcatgcgctt caaggtgcac atggagggct ccgtgaacgg ccacgagttc

     5941 gagatcgagg gcgagggcga gggccgcccc tacgagggca cccagaccgc caagctgaag

     6001 gtgaccaagg gtggccccct gcccttcgcc tgggacatcc tgtcccctca gttcatgtac

     6061 ggctccaagg cctacgtgaa gcaccccgcc gacatccccg actacttgaa gctgtccttc

     6121 cccgagggct tcaagtggga gcgcgtgatg aacttcgagg acggcggcgt ggtgaccgtg

     6181 acccaggact cctccctgca ggacggcgag ttcatctaca aggtgaagct gcgcggcacc

     6241 aacttcccct ccgacggccc cgtaatgcag aagaagacca tgggctggga ggcctcctcc

     6301 gagcggatgt accccgagga cggcgccctg aagggcgaga tcaagcagag gctgaagctg

     6361 aaggacggcg gccactacga cgctgaggtc aagaccacct acaaggccaa gaagcccgtg

     6421 cagctgcccg gcgcctacaa cgtcaacatc aagttggaca tcacctccca caacgaggac

     6481 tacaccatcg tggaacagta cgaacgcgcc gagggccgcc actccaccgg cggcatggac

     6541 gagctgtaca agtgagagct cgaatttccc cgatcgttca aacatttggc aataaagttt

     6601 cttaagattg aatcctgttg ccggtcttgc gatgattatc atataatttc tgttgaatta

     6661 cgttaagcat gtaataatta acatgtaatg catgacgtta tttatgagat gggtttttat

     6721 gattagagtc ccgcaattat acatttaata cgcgatagaa aacaaaatat agcgcgcaaa

     6781 ctaggataaa ttatcgcgcg cggtgtcatc tatgttacta gatcgggaat tcactggccg

     6841 tcgttttaca acgtcgtgac tgggaaaacc ctggcgttac ccaacttaat cgccttgcag

     6901 cacatccccc tttcgccagc tggcgtaata gcgaagaggc ccgcaccgat cgcccttccc

     6961 aacagttgcg cagcctgaat ggcgcccgct cctttcgctt tcttcccttc ctttctcgcc

     7021 acgttcgccg gctttccccg tcaagctcta aatcgggggc tccctttagg gttccgattt

     7081 agtgctttac ggcacctcga ccccaaaaaa cttgatttgg gtgatggttc acgtagtggg

     7141 ccatcgccct gatagacggt ttttcgccct ttgacgttgg agtccacgtt ctttaatagt

     7201 ggactcttgt tccaaactgg aacaacactc aaccctatct cgggctattc ttttgattta

     7261 taagggattt tgccgatttc ggaaccacca tcaaacagga ttttcgcctg ctggggcaaa

     7321 ccagcgtgga ccgcttgctg caactctctc agggccaggc ggtgaagggc aatcagctgt

     7381 tgcccgtctc actggtgaaa agaaaaacca ccccagtaca ttaaaaacgt ccgcaatgtg

     7441 ttattaagtt gtctaagcgt caatttgttt acaccacaat atatcctgcc accagccagc

     7501 caacagctcc ccgaccggca gctcggcaca aaatcaccac tcgatacagg cagcccatca

     7561 gtccgggacg gcgtcagcgg gagagccgtt gtaaggcggc agactttgct catgttaccg

     7621 atgctattcg gaagaacggc aactaagctg ccgggtttga aacacggatg atctcgcgga

     7681 gggtagcatg ttgattgtaa cgatgacaga gcgttgctgc ctgtgatcaa atatcatctc

     7741 cctcgcagag atccgaatta tcagccttct tattcatttc tcgcttaacc gtgacaggct

     7801 gtcgatcttg agaactatgc cgacataata ggaaatcgct ggataaagcc gctgaggaag

     7861 ctgagtggcg ctatttcttt agaagtgaac gttgacgata tcaactcccc tatccattgc

     7921 tcaccgaatg gtacaggtcg gggacccgaa gttccgactg tcggcctgat gcatccccgg

     7981 ctgatcgacc ccagatctgg ggctgagaaa gcccagtaag gaaacaactg taggttcgag

     8041 tcgcgagatc ccccggaacc aaaggaagta ggttaaaccc gctccgatca ggccgagcca

     8101 cgccaggccg agaacattgg ttcctgtagg catcgggatt ggcggatcaa acactaaagc

     8161 tactggaacg agcagaagtc ctccggccgc cagttgccag gcggtaaagg tgagcagagg

     8221 cacgggaggt tgccacttgc gggtcagcac ggttccgaac gccatggaaa ccgcccccgc

     8281 caggcccgct gcgacgccga caggatctag cgctgcgttt ggtgtcaaca ccaacagcgc

     8341 cacgcccgca gttccgcaaa tagcccccag gaccgccatc aatcgtatcg ggctacctag

     8401 cagagcggca gagatgaaca cgaccatcag cggctgcaca gcgcctaccg tcgccgcgac

     8461 cccgcccggc aggcggtaga ccgaaataaa caacaagctc cagaatagcg aaatattaag

     8521 tgcgccgagg atgaagatgc gcatccacca gattcccgtt ggaatctgtc ggacgatcat

     8581 cacgagcaat aaacccgccg gcaacgcccg cagcagcata ccggcgaccc ctcggcctcg

     8641 ctgttcgggc tccacgaaaa cgccggacag atgcgccttg tgagcgtcct tggggccgtc

     8701 ctcctgtttg aagaccgaca gcccaatgat ctcgccgtcg atgtaggcgc cgaatgccac

     8761 ggcatctcgc aaccgttcag cgaacgcctc catgggcttt ttctcctcgt gctcgtaaac

     8821 ggacccgaac atctctggag ctttcttcag ggccgacaat cggatctcgc ggaaatcctg

     8881 cacgtcggcc gctccaagcc gtcgaatctg agccttaatc acaattgtca attttaatcc

     8941 tctgtttatc ggcagttcgt agagcgcgcc gtgcgtcccg agcgatactg agcgaagcaa

     9001 gtgcgtcgag cagtgcccgc ttgttcctga aatgccagta aagcgctggc tgctgaaccc

     9061 ccagccggaa ctgaccccac aaggccctag cgtttgcaat gcaccaggtc atcattgacc

     9121 caggcgtgtt ccaccaggcc gctgcctcgc aactcttcgc aggcttcgcc gacctgctcg

     9181 cgccacttct tcacgcgggt ggaatccgat ccgcacatga ggcggaaggt ttccagcttg

     9241 agcgggtacg gctcccggtg cgagctgaaa tagtcgaaca tccgtcgggc cgtcggcgac

     9301 agcttgcggt acttctccca tatgaatttc gtgtagtggt cgccagcaaa cagcacgacg

     9361 atttcctcgt cgatcaggac ctggcaacgg gacgttttct tgccacggtc caggacgcgg

     9421 aagcggtgca gcagcgacac cgattccagg tgcccaacgc ggtcggacgt gaagcccatc

     9481 gccgtcgcct gtaggcgcga caggcattcc tcggccttcg tgtaataccg gccattgatc

     9541 gaccagccca ggtcctggca aagctcgtag aacgtgaagg tgatcggctc gccgataggg

     9601 gtgcgcttcg cgtactccaa cacctgctgc cacaccagtt cgtcatcgtc ggcccgcagc

     9661 tcgacgccgg tgtaggtgat cttcacgtcc ttgttgacgt ggaaa

No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart