pBSFI- myr- akt1

$215.00

  • Model: PVT10429
  • 50 Units in Stock
Ask a question


Add to Cart:

pBSFI-myr-akt1

Catalog No. PVT10429
Packing 2ug

 

pBSFI-myr-akt1 Information

Prokaryotic resistance: Amp

Clone strain: DH5a

Culture conditions: 37℃

Plasmid host: Escherichia coli

Plasmid use: gene template

Fragment type: ORF

Fragment species: Mouse

Prokaryotic resistance: Amp

 

pBSFI-myr-akt1 Description

pBSFI-myr-akt1 is a gene template plasmid, which size is 4477bp, resistance is Amp.

 

pBSFI-myr-akt1 Sequence

LOCUS       Exported                4477 bp ds-DNA     circular SYN 30-SEP-2017

DEFINITION  synthetic circular DNA

ACCESSION   .

VERSION     .

KEYWORDS    .

SOURCE      synthetic DNA construct

  ORGANISM  synthetic DNA construct

REFERENCE   1  (bases 1 to 4477)

  AUTHORS   .

  TITLE     Direct Submission

FEATURES             Location/Qualifiers

     source          1..4477

                     /organism="synthetic DNA construct"

                     /mol_type="other DNA"

     misc_feature    63..95

                     /label=myristolation signal

     misc_feature    96..1535

                     /label=Akt1

     CDS             1536..1562

                     /codon_start=1

                     /product="HA (human influenza hemagglutinin) epitope tag"

                     /label=HA

                     /translation="YPYDVPDYA"

     promoter        complement(1632..1650)

                     /label=T7 promoter

                     /note="promoter for bacteriophage T7 RNA polymerase"

     primer_bind     complement(1660..1676)

                     /label=M13 fwd

                     /note="common sequencing primer, one of multiple similar 

                     variants"

     rep_origin      complement(1817..2272)

                     /direction=LEFT

                     /label=f1 ori

                     /note="f1 bacteriophage origin of replication; arrow 

                     indicates direction of (+) strand synthesis"

     promoter        2299..2403

                     /gene="bla"

                     /label=AmpR promoter

     CDS             2404..3264

                     /codon_start=1

                     /gene="bla"

                     /product="beta-lactamase"

                     /label=AmpR

                     /note="confers resistance to ampicillin, carbenicillin, and

                     related antibiotics"

                     /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI

                     ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVEYS

                     PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW

                     EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA

                     LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS

                     LIKHW"

     rep_origin      3435..4023

                     /direction=RIGHT

                     /label=ori

                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 

                     replication"

     primer_bind     4409..4425

                     /label=M13 rev

                     /note="common sequencing primer, one of multiple similar 

                     variants"

     promoter        4446..4464

                     /label=T3 promoter

                     /note="promoter for bacteriophage T3 RNA polymerase"

ORIGIN

        1 agctggccat tacggccgcg gccgcctcta gaggatctgg taccacgcgt atcgataagc

       61 ttatggggag cagcaagagc aagcccaagt ctagaatgaa cgacgtagcc attgtgaagg

      121 agggctggct gcacaaacga ggggaatata ttaaaacctg gcggccacgc tacttcctcc

      181 tcaagaacga tggcaccttt attggctaca aggaacggcc tcaggatgtg gatcagcgag

      241 agtccccact caacaacttc tcagtggcac aatgccagct gatgaagaca gagcggccaa

      301 ggcccaacac ctttatcatc cgctgcctgc agtggaccac agtcattgag cgcaccttcc

      361 atgtggaaac gcctgaggag cgggaagaat gggccaccgc cattcagact gtggccgatg

      421 gactcaagag gcaggaagaa gagacgatgg acttccgatc aggctcaccc agtgacaact

      481 caggggctga agagatggag gtgtccctgg ccaagcccaa gcaccgtgtg accatgaacg

      541 agtttgagta cctgaaacta ctgggcaagg gcacctttgg gaaagtgatt ctggtgaaag

      601 agaaggccac aggccgctac tatgccatga agatcctcaa gaaggaggtc atcgtcgcca

      661 aggatgaggt tgcccacacg cttactgaga accgtgtcct gcagaactct aggcatccct

      721 tccttacggc cctcaagtac tcattccaga cccacgaccg cctctgcttt gtcatggagt

      781 atgccaacgg gggcgagctc ttcttccacc tgtctcgaga gcgcgtgttc tccgaggacc

      841 gggcccgctt ctatggtgcg gagattgtgt ctgccctgga ctacttgcac tccgagaaga

      901 acgtggtgta ccgggacctg aagctggaga acctcatgct ggacaaggac gggcacatca

      961 agataacgga cttcgggctg tgcaaggagg ggatcaagga tggtgccact atgaagacat

     1021 tctgcggaac gccggagtac ctggcccctg aggtgctgga ggacaacgac tacggccgtg

     1081 cagtggactg gtgggggctg ggcgtggtca tgtatgagat gatgtgtggc cgcctgccct

     1141 tctacaacca ggaccacgag aagctgttcg agctgatcct catggaggag atccgcttcc

     1201 cgcgcacact cggccctgag gccaagtccc tgctctccgg gctgctcaag aaggacccta

     1261 cacagaggct cggtgggggc tctgaggatg ccaaggagat catgcagcac cggttctttg

     1321 ccaacatcgt gtggcaggat gtgtatgaga agaagctgag cccacctttc aagccccagg

     1381 tcacctctga gactgacacc aggtatttcg atgaggagtt cacagctcag atgatcacca

     1441 tcacgccgcc tgatcaagat gacagcatgg agtgtgtgga cagtgagcgg aggccgcact

     1501 tcccccagtt ctcctactca gccagtggca cagcctaccc atacgatgtt ccagattacg

     1561 cttctagatg aattcacgcg taagcttatc gatgtcgacg ggcccggccg cctcggccgt

     1621 acccaattcg ccctatagtg agtcgtatta cgcgcgctca ctggccgtcg ttttacaacg

     1681 tcgtgactgg gaaaaccctg gcgttaccca acttaatcgc cttgcagcac atcccccttt

     1741 cgccagctgg cgtaatagcg aagaggcccg caccgatcgc ccttcccaac agttgcgcag

     1801 cctgaatggc gaatggaaat tgtaagcgtt aatattttgt taaaattcgc gttaaatttt

     1861 tgttaaatca gctcattttt ttaaccaata ggccgaaatc ggcaaaatcc cttataaatc

     1921 aaaagataga ccgagatagg gttgagtgtt gttccagttt ggaacaagag tccactatta

     1981 aagaacgtgg actccaacgt caaagggcga aaaaccgtct atcagggcga tggcccacta

     2041 cgtgaaccat caccctaatc aagttttttg gggtcgaggt gccgtaaagc actaaatcgg

     2101 aaccctaaag ggagcccccg atttagagct tgacggggaa agccggcgaa cgtggcgaga

     2161 aaggaaggga agaaagcgaa aggagcgggc gctagggcgc tggcaagtgt agcggtcacg

     2221 ctgcgcgtaa ccaccacacc cgccgcgctt aatgcgccgc tacagggcgc gtcaggtggc

     2281 acttttcggg gaaatgtgcg cggaacccct atttgtttat ttttctaaat acattcaaat

     2341 atgtatccgc tcatgagaca ataaccctga taaatgcttc aataatattg aaaaaggaag

     2401 agtatgagta ttcaacattt ccgtgtcgcc cttattccct tttttgcggc attttgcctt

     2461 cctgtttttg ctcacccaga aacgctggtg aaagtaaaag atgctgaaga tcagttgggt

     2521 gcacgagtgg gttacatcga actggatctc aacagcggta agatccttga gagttttcgc

     2581 cccgaagaac gttttccaat gatgagcact tttaaagttc tgctatgtgg cgcggtatta

     2641 tcccgtattg acgccgggca agagcaactc ggtcgccgca tacactattc tcagaatgac

     2701 ttggttgagt actcaccagt cacagaaaag catcttacgg atggcatgac agtaagagaa

     2761 ttatgcagtg ctgccataac catgagtgat aacactgcgg ccaacttact tctgacaacg

     2821 atcggaggac cgaaggagct aaccgctttt ttgcacaaca tgggggatca tgtaactcgc

     2881 cttgatcgtt gggaaccgga gctgaatgaa gccataccaa acgacgagcg tgacaccacg

     2941 atgcctgtag caatggcaac aacgttgcgc aaactattaa ctggcgaact acttactcta

     3001 gcttcccggc aacaattaat agactggatg gaggcggata aagttgcagg accacttctg

     3061 cgctcggccc ttccggctgg ctggtttatt gctgataaat ctggagccgg tgagcgtggg

     3121 tctcgcggta tcattgcagc actggggcca gatggtaagc cctcccgtat cgtagttatc

     3181 tacacgacgg ggagtcaggc aactatggat gaacgaaata gacagatcgc tgagataggt

     3241 gcctcactga ttaagcattg gtaactgtca gaccaagttt actcatatat actttagatt

     3301 gatttaaaac ttcattttta atttaaaagg atctaggtga agatcctttt tgataatctc

     3361 atgaccaaaa tcccttaacg tgagttttcg ttccactgag cgtcagaccc cgtagaaaag

     3421 atcaaaggat cttcttgaga tccttttttt ctgcgcgtaa tctgctgctt gcaaacaaaa

     3481 aaaccaccgc taccagcggt ggtttgtttg ccggatcaag agctaccaac tctttttccg

     3541 aaggtaactg gcttcagcag agcgcagata ccaaatactg tccttctagt gtagccgtag

     3601 ttaggccacc acttcaagaa ctctgtagca ccgcctacat acctcgctct gctaatcctg

     3661 ttaccagtgg ctgctgccag tggcgataag tcgtgtctta ccgggttgga ctcaagacga

     3721 tagttaccgg ataaggcgca gcggtcgggc tgaacggggg gttcgtgcac acagcccagc

     3781 ttggagcgaa cgacctacac cgaactgaga tacctacagc gtgagctatg agaaagcgcc

     3841 acgcttcccg aagggagaaa ggcggacagg tatccggtaa gcggcagggt cggaacagga

     3901 gagcgcacga gggagcttcc agggggaaac gcctggtatc tttatagtcc tgtcgggttt

     3961 cgccacctct gacttgagcg tcgatttttg tgatgctcgt caggggggcg gagcctatgg

     4021 aaaaacgcca gcaacgcggc ctttttacgg ttcctggcct tttgctggcc ttttgctcac

     4081 atgttctttc ctgcgttatc ccctgattct gtggataacc gtattaccgc ctttgagtga

     4141 gctgataccg ctcgccgcag ccgaacgacc gagcgcagcg agtcagtgag cgaggaagcg

     4201 gaagagcgcc caatacgcaa accgcctctc cccgcgcgtt ggccgattca ttaatgcagc

     4261 tggcacgaca ggtttcccga ctggaaagcg ggcagtgagc gcaacgcaat taatgtgagt

     4321 tagctcactc attaggcacc ccaggcttta cactttatgc ttccggctcg tatgttgtgt

     4381 ggaattgtga gcggataaca atttcacaca ggaaacagct atgaccatga ttacgccaag

     4441 ctcgaaatta accctcacta aagggaacaa aagctgg

//

No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart