pC013- Twinstrep- SUMO- huLwCas13a

$193.00

  • Model: PVT10659
  • 50 Units in Stock
Ask a question


Add to Cart:

pC013-Twinstrep-SUMO-huLwCas13a


Catalog No. PVT10659
Packing 2ug

 

pC013-Twinstrep-SUMO-huLwCas13a Information
Function E.coli Editing plasmids
Resistance Amp
Screen /
Strain Stbl3
Culture temperature 37degrees centigrade
Replicon
Copy Low
Promoter
Induction
Forward primer
Reverse primer

 

pC013-Twinstrep-SUMO-huLwCas13a Description

pC013-Twinstrep-SUMO-huLwCas13a is a E.coli Editing plasmids with Ampicillin resistance. And plasmid size is 9542 bp.

 

pC013-Twinstrep-SUMO-huLwCas13a Sequence

LOCUS       Exported                9542 bp ds-DNA     circular SYN 27-SEP-2017

DEFINITION  synthetic circular DNA

ACCESSION   .

VERSION     .

KEYWORDS    .

SOURCE      synthetic DNA construct

  ORGANISM  synthetic DNA construct

REFERENCE   1  (bases 1 to 9542)

  AUTHORS   .

  TITLE     Direct Submission

  JOURNAL   Exported Sep 27, 2017

FEATURES             Location/Qualifiers

     source          1..9542

                     /organism="synthetic DNA construct"

                     /mol_type="other DNA"

     misc_feature    278..417

                     /label=bom

                     /note="basis of mobility region from pBR322"

     rep_origin      complement(603..1191)

                     /direction=LEFT

                     /label=ori

                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 

                     replication"

     CDS             complement(1362..2222)

                     /codon_start=1

                     /gene="bla"

                     /product="beta-lactamase"

                     /label=AmpR

                     /note="confers resistance to ampicillin, carbenicillin, and

                     related antibiotics"

                     /translation="[TEM beta-lactamase fragment, 45 aa]

                     ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS

                     [TEM beta-lactamase fragment, 59 aa]

                     EPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA

                     [TEM beta-lactamase fragment, 59 aa]

                     LIKHW"

     promoter        complement(2223..2327)

                     /gene="bla"

                     /label=AmpR promoter

     terminator      2643..2690

                     /label=T7 terminator

                     /note="transcription terminator for bacteriophage T7 RNA 

                     polymerase"

     CDS             complement(2751..6209)

                     /codon_start=1

                     /label=LwCas13a

                     /translation="MKVTKVDGISHKKYIEEGKLVKSTSEENRTSERLSELLSIRLDIY

                     IKNPDNASEEENRIRRENLKKFFSNKVLHLKDSVLYLKNRKEKNAVQDKNYSEEDISEY

                     DLKNKNSFSVLKKILLNEDVNSEELEIFRKDVEAKLNKINSLKYSFEENKANYQKINEN

                     NVEKVGGKSKRNIIYDYYRESAKRNDYINNVQEAFDKLYKKEDIEKLFFLIENSKKHEK

                     YKIREYYHKIIGRKNDKENFAKIIYEEIQNVNNIKELIEKIPDMSELKKSQVFYKYYLD

                     KEELNDKNIKYAFCHFVEIEMSQLLKNYVYKRLSNISNDKIKRIFEYQNLKKLIENKLL

                     NKLDTYVRNCGKYNYYLQVGEIATSDFIARNRQNEAFLRNIIGVSSVAYFSLRNILETE

                     NENDITGRMRGKTVKNNKGEEKYVSGEVDKIYNENKQNEVKENLKMFYSYDFNMDNKNE

                     IEDFFANIDEAISSIRHGIVHFNLELEGKDIFAFKNIAPSEISKKMFQNEINEKKLKLK

                     IFKQLNSANVFNYYEKDVIIKYLKNTKFNFVNKNIPFVPSFTKLYNKIEDLRNTLKFFW

                     SVPKDKEEKDAQIYLLKNIYYGEFLNKFVKNSKVFFKITNEVIKINKQRNQKTGHYKYQ

                     KFENIEKTVPVEYLAIIQSREMINNQDKEEKNTYIDFIQQIFLKGFIDYLNKNNLKYIE

                     SNNNNDNNDIFSKIKIKKDNKEKYDKILKNYEKHNRNKEIPHEINEFVREIKLGKILKY

                     TENLNMFYLILKLLNHKELTNLKGSLEKYQSANKEETFSDELELINLLNLDNNRVTEDF

                     ELEANEIGKFLDFNENKIKDRKELKKFDTNKIYFDGENIIKHRAFYNIKKYGMLNLLEK

                     IADKAKYKISLKELKEYSNKKNEIEKNYTMQQNLHRKYARPKKDEKFNDEDYKEYEKAI

                     GNIQKYTHLKNKVEFNELNLLQGLLLKILHRLVGYTSIWERDLRFRLKGEFPENHYIEE

                     IFNFDNSKNVKYKSGQIVEKYINFYKELYKDNVEKRSIYSDKKVKKLKQEKKDLYIRNY

                     IAHFNYIPHAEISLLEVLENLRKLLSYDRKLKNAIMKSIVDILKEYGFVATFKIGADKK

                     IEIQTLESEKIVHLKNLKKKKLMTDRNSEELCELVKVMFEYKALE"

     CDS             complement(6216..6506)

                     /codon_start=1

                     /gene="S. cerevisiae SMT3 (truncated)"

                     /product="cleavable ubiquitin-like protein tag"

                     /label=SUMO

                     /translation="MSDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPL

                     RRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIG"

     CDS             complement(6507..6530)

                     /codon_start=1

                     /product="peptide that binds Strep-Tactin(R), an engineered

                     form of streptavidin"

                     /label=Strep-Tag II

                     /translation="WSHPQFEK"

     CDS             complement(6567..6590)

                     /codon_start=1

                     /product="peptide that binds Strep-Tactin(R), an engineered

                     form of streptavidin"

                     /label=Strep-Tag II

                     /translation="WSHPQFEK"

     CDS             complement(6603..6620)

                     /codon_start=1

                     /product="thrombin recognition and cleavage site"

                     /label=thrombin site

                     /translation="LVPRGS"

     CDS             complement(6630..6647)

                     /codon_start=1

                     /product="6xHis affinity tag"

                     /label=6xHis

                     /translation="HHHHHH"

     RBS             6666..6688

                     /note="efficient ribosome binding site from bacteriophage 

                     T7 gene 10 (Olins and Rangwala, 1989)"

     protein_bind    6703..6727

                     /label=lac operator

                     /bound_moiety="lac repressor encoded by lacI"

                     /note="The lac repressor binds to the lac operator to 

                     inhibit transcription in E. coli. This inhibition can be 

                     relieved by adding lactose or 

                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."

     promoter        complement(6728..6746)

                     /label=T7 promoter

                     /note="promoter for bacteriophage T7 RNA polymerase"

     promoter        7055..7132

                     /gene="lacI"

                     /label=lacI promoter

     CDS             7133..8215

                     /codon_start=1

                     /gene="lacI"

                     /product="lac repressor"

                     /label=lacI

                     /note="The lac repressor binds to the lac operator to 

                     inhibit transcription in E. coli. This inhibition can be 

                     relieved by adding lactose or 

                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."

                     /translation="MKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAEL

                     NYIPNRVAQQLAGKQSLLIGVATSSLALHAPSQIVAAIKSRADQLGASVVVSMVERSGV

                     EACKAAVHNLLAQRVSGLIINYPLDDQDAIAVEAACTNVPALFLDVSDQTPINSIIFSH

                     EDGTRLGVEHLVALGHQQIALLAGPLSSVSARLRLAGWHKYLTRNQIQPIAEREGDWSA

                     MSGFQQTMQMLNEGIVPTAMLVANDQMALGAMRAITESGLRVGADISVVGYDDTEDSSC

                     YIPPLTTIKQDFRLLGQTSVDRLLQLSQGQAVKGNQLLPVSLVKRKTTLAPNTQTASPR

                     ALADSLMQLARQVSRLESGQ"

     CDS             9527..176

                     /codon_start=1

                     /gene="rop"

                     /product="Rop protein, which maintains plasmids at low copy

                     number"

                     /label=rop

                     /translation="MTKQEKTALNMARFIRSQTLTLLEKLNELDADEQADICESLHDHA

                     DELYRSCLARFGDDGENL"

ORIGIN

        1 aaaccgccct taacatggcc cgctttatca gaagccagac attaacgctt ctggagaaac

       61 tcaacgagct ggacgcggat gaacaggcag acatctgtga atcgcttcac gaccacgctg

      121 atgagcttta ccgcagctgc ctcgcgcgtt tcggtgatga cggtgaaaac ctctgacaca

      181 tgcagctccc ggagacggtc acagcttgtc tgtaagcgga tgccgggagc agacaagccc

      241 gtcagggcgc gtcagcgggt gttggcgggt gtcggggcgc agccatgacc cagtcacgta

      301 gcgatagcgg agtgtatact ggcttaacta tgcggcatca gagcagattg tactgagagt

      361 gcaccattgc ggtgtgaaat accgcacaga tgcgtaagga gaaaataccg catcaggcgc

      421 tcttccgctt cctcgctcac tgactcgctg cgctcggtcg ttcggctgcg gcgagcggta

      481 tcagctcact caaaggcggt aatacggtta tccacagaat caggggataa cgcaggaaag

      541 aacatgtgag caaaaggcca gcaaaaggcc aggaaccgta aaaaggccgc gttgctggcg

      601 tttttccata ggctccgccc ccctgacgag catcacaaaa atcgacgctc aagtcagagg

      661 tggcgaaacc cgacaggact ataaagatac caggcgtttc cccctggaag ctccctcgtg

      721 cgctctcctg ttccgaccct gccgcttacc ggatacctgt ccgcctttct cccttcggga

      781 agcgtggcgc tttctcatag ctcacgctgt aggtatctca gttcggtgta ggtcgttcgc

      841 tccaagctgg gctgtgtgca cgaacccccc gttcagcccg accgctgcgc cttatccggt

      901 aactatcgtc ttgagtccaa cccggtaaga cacgacttat cgccactggc agcagccact

      961 ggtaacagga ttagcagagc gaggtatgta ggcggtgcta cagagttctt gaagtggtgg

     1021 cctaactacg gctacactag aaggacagta tttggtatct gcgctctgct gaagccagtt

     1081 accttcggaa aaagagttgg tagctcttga tccggcaaac aaaccaccgc tggtagcggt

     1141 ggtttttttg tttgcaagca gcagattacg cgcagaaaaa aaggatctca agaagatcct

     1201 ttgatctttt ctacggggtc tgacgctcag tggaacgaaa actcacgtta agggattttg

     1261 gtcatgagat tatcaaaaag gatcttcacc tagatccttt taaattaaaa atgaagtttt

     1321 aaatcaatct aaagtatata tgagtaaact tggtctgaca gttaccaatg cttaatcagt

     1381 gaggcaccta tctcagcgat ctgtctattt cgttcatcca tagttgcctg actccccgtc

     1441 gtgtagataa ctacgatacg ggagggctta ccatctggcc ccagtgctgc aatgataccg

     1501 cgagacccac gctcaccggc tccagattta tcagcaataa accagccagc cggaagggcc

     1561 gagcgcagaa gtggtcctgc aactttatcc gcctccatcc agtctattaa ttgttgccgg

     1621 gaagctagag taagtagttc gccagttaat agtttgcgca acgttgttgc cattgctgca

     1681 ggcatcgtgg tgtcacgctc gtcgtttggt atggcttcat tcagctccgg ttcccaacga

     1741 tcaaggcgag ttacatgatc ccccatgttg tgcaaaaaag cggttagctc cttcggtcct

     1801 ccgatcgttg tcagaagtaa gttggccgca gtgttatcac tcatggttat ggcagcactg

     1861 cataattctc ttactgtcat gccatccgta agatgctttt ctgtgactgg tgagtactca

     1921 accaagtcat tctgagaata gtgtatgcgg cgaccgagtt gctcttgccc ggcgtcaaca

     1981 cgggataata ccgcgccaca tagcagaact ttaaaagtgc tcatcattgg aaaacgttct

     2041 tcggggcgaa aactctcaag gatcttaccg ctgttgagat ccagttcgat gtaacccact

     2101 cgtgcaccca actgatcttc agcatctttt actttcacca gcgtttctgg gtgagcaaaa

     2161 acaggaaggc aaaatgccgc aaaaaaggga ataagggcga cacggaaatg ttgaatactc

     2221 atactcttcc tttttcaata ttattgaagc atttatcagg gttattgtct catgagcgga

     2281 tacatatttg aatgtattta gaaaaataaa caaatagggg ttccgcgcac atttccccga

     2341 aaagtgccac ctgacgtcta agaaaccatt attatcatga cattaaccta taaaaatagg

     2401 cgtatcacga ggccctttcg tcttcaagaa ttctcatgtt tgacagctta tcatcgataa

     2461 gctttaatgc ggtagtttat cacagttaaa ttgctaacgc agtcaggcac cgtgtatgaa

     2521 atctaacaat gcgctcatcg tcatcctcgg caccgtcacc ctggatgctg taggcatagg

     2581 cttggttatg ccggtactgc cgggcctctt gcgggatatc cggatatagt tcctcctttc

     2641 agcaaaaaac ccctcaagac ccgtttagag gccccaaggg gttatgctag ttattgctca

     2701 gcggtggcag cagccaactc agcttccttt cgggcctcga gtgcggccgc ttattccagg

     2761 gccttgtact cgaacatgac tttcacgagt tcgcacagtt cctcgctgtt ccggtcggtc

     2821 atcagtttct ttttcttcag attcttcagg tgcacgatct tctctgattc cagggtctgg

     2881 atttcgatct tcttgtcagc gccgatcttg aaggtggcca cgaagccgta ttctttcaga

     2941 atgtccacga tggacttcat gatggcgttc ttcagcttcc ggtcgtagga cagcagcttc

     3001 cgcaggtttt ccagcacttc cagcaggcta atctcggcgt gggggatgta gttgaagtgg

     3061 gcaatgtagt tccggatgta caggtccttt ttttcctgct tcagtttctt cactttcttg

     3121 tcggagtaga tgctccgctt ttccacattg tccttgtaca gttctttgta gaagttgata

     3181 tacttttcca cgatctggcc gcttttgtac ttcacattct tggagttgtc gaaattgaaa

     3241 atttcctcga tgtagtggtt ctcgggaaac tcgcccttca gccggaatct caggtcccgc

     3301 tcccagatgc tggtgtagcc cacgagccgg tgcaggatct tcagcagcag gccctgcagc

     3361 aggttcagct cattgaattc caccttgttc ttcaggtggg tgtacttctg gatgttgccg

     3421 atggccttct catactcttt gtagtcctcg tcgttgaact tttcgtcctt cttgggtctg

     3481 gcgtacttcc ggtgcaggtt ctgctgcatg gtgtagttct tttcaatctc attcttcttg

     3541 ttgctgtact ctttcagttc tttcaggctg atcttatact tggccttatc ggcgatcttt

     3601 tccagcagat tcagcatgcc gtatttcttg atattgtaga aggcccggtg cttgatgatg

     3661 ttctcgccgt cgaaatagat cttgttggtg tcgaactttt tcagctcttt ccggtccttg

     3721 attttgtttt cgttgaagtc caggaacttg ccgatctcgt tggcttccag ctcgaagtcc

     3781 tcggtcactc tgttgttgtc caggttcagc aggttgatca gttccagctc gtcgctgaag

     3841 gtttcttctt tgttggcgga ctggtacttt tccaggctgc ccttcaggtt ggtcagctct

     3901 ttgtggttca gcagcttcag gatcaggtaa aacatgttca gattctcggt gtacttcaga

     3961 atcttcccca gcttgatctc gcgcacgaac tcattgatct cgtgagggat ttctttgttc

     4021 cgattgtgct tctcatagtt cttcaggatc ttgtcgtact tctctttgtt atcctttttg

     4081 atcttgatct tggagaagat gtcgttgttg tcattgttgt tgttgctctc gatatacttc

     4141 agattgttct tgttcaggta gtcgatgaag cccttcagga aaatctgctg aataaagtcg

     4201 atgtaggtat tcttttcctc tttgtcctgg ttgttgatca tctctctgct ctggatgatg

     4261 gccaggtatt ccacgggcac ggttttctcg atgttctcga acttctgata cttgtagtgg

     4321 ccggttttct ggttccgctg cttgttaatc ttgatcactt cattggtgat cttaaagaac

     4381 accttggagt ttttcacgaa cttgttcagg aactcgccgt agtagatatt cttcagcagg

     4441 tagatctggg cgtccttctc ttctttgtcc ttgggcacgc tccaaaaaaa cttcagggta

     4501 ttccgcaggt cctcaatctt gttgtacagc ttggtgaagc tgggcacgaa ggggatgttt

     4561 ttgttcacga agttgaactt ggtattcttc aggtacttga tgatcacatc cttctcgtag

     4621 tagttgaaca cgttggcgct gttcagctgc ttgaagattt tcagcttcag cttcttttcg

     4681 ttgatttcgt tctgaaacat cttcttggag atctcgctgg gggcgatatt cttgaaggcg

     4741 aagatgtcct tgccttccag ttccaggttg aagtgcacga tgccgtgtct gatgctgctg

     4801 atggcctcgt cgatgttggc gaagaagtcc tcgatctcgt tcttgttgtc catgttgaag

     4861 tcgtagctgt agaacatctt cagattttct ttcacttcgt tctgcttgtt ctcattgtag

     4921 atcttgtcca cctcgccgga cacgtatttc tcttcgccct tgttgttctt cacggtcttg

     4981 ccccgcatcc ggccggtgat atcgttctcg ttctcggttt ccaggatgtt cctcaggctg

     5041 aagtaggcca cgctggacac gccgatgatg tttctcagga aggcctcgtt ctgccggttc

     5101 cgggcgataa agtcggaggt ggcgatctcg cccacttgca gatagtagtt gtacttgccg

     5161 cagttccgca cgtaggtgtc cagcttgttc agcagtttgt tttcgatcag ctttttcaga

     5221 ttctggtact cgaagatccg cttgatctta tcgttgctga tgttgctcag ccgcttgtac

     5281 acgtagtttt tcagcagctg ggacatctcg atttccacga agtggcagaa ggcgtactta

     5341 atattcttgt cgttcagttc ctctttgtcc aggtagtact tgtagaacac ctggcttttc

     5401 ttcagctcag acatgtcggg gatcttctca atcagctctt tgatgttgtt cacgttctgg

     5461 atctcttcgt agataatctt ggcgaagttc tctttgtcgt tcttccggcc gatgatcttg

     5521 tgatagtact cgcggatctt gtacttctcg tgcttcttgc tgttctcgat caggaaaaac

     5581 agtttctcga tatcctcttt cttatacagc ttgtcgaagg cttcctgcac gttgttgatg

     5641 tagtcgttgc gcttggcgct ctctctgtag tagtcgtaga tgatgttccg cttgctcttg

     5701 ccgcccactt tttccacgtt gttctcgttg atcttctggt agttggcctt gttctcttcg

     5761 aagctgtact tcaggctgtt gatcttgttc agcttggctt ccacgtcctt ccgaaagatt

     5821 tccagttcct cagagttcac gtcctcgttc agcaggatct tcttcagcac ggagaagctg

     5881 ttcttgtttt tcaggtcgta ctcgctgatg tcctcttcgc tatagttctt gtcctgcacg

     5941 gcgttctttt ctttccggtt cttcagatac agcacgctgt ccttcaggtg cagcaccttg

     6001 ttgctaaaga acttcttcag gttctctctt ctgatccggt tctcttcctc ggaggcgttg

     6061 tcggggttct tgatgtagat gtccagccgg atgctcagca gctcgctcag tctctcgctg

     6121 gtccggtttt cctcgctggt ggacttcacg agcttgccct cttcgatgta cttcttgtgg

     6181 ctgatgccgt cgaccttggt cactttcatg gatccaccaa tctgttctct gtgagcctca

     6241 ataatatcgt tatcctccat gtccaaatct tcaggggtct gatcagcttg gattctaata

     6301 ccgtcgtaca agaatcttaa ggagtccatt tccttaccct gtcttttagc gaacgcttcc

     6361 atcagccttc ttaaaggagt ggtctttttg atcttgaaga agatctctga agatccatcg

     6421 gacaccttta aattgatgtg agtctcaggc ttgacttctg gcttgacctc tggcttagct

     6481 tcttgattga cttctgagtc cgacattttc tcaaactgag ggtgtgacca tgcactacca

     6541 cctgaaccac caccgctacc accacctttt tcaaactgcg gatggctcca gctagccata

     6601 tggctgccgc gcggcaccag gccgctgctg tgatgatgat gatgatggct gctgcccatg

     6661 gtatatctcc ttcttaaagt taaacaaaat tatttctaga ggggaattgt tatccgctca

     6721 caattcccct atagtgagtc gtattaattt cgcgggatcg agatctcgat cctctacgcc

     6781 ggacgcatcg tggccggcat caccggcgcc acaggtgcgg ttgctggcgc ctatatcgcc

     6841 gacatcaccg atggggaaga tcgggctcgc cacttcgggc tcatgagcgc ttgtttcggc

     6901 gtgggtatgg tggcaggccc cgtggccggg ggactgttgg gcgccatctc cttgcatgca

     6961 ccattccttg cggcggcggt gctcaacggc ctcaacctac tactgggctg cttcctaatg

     7021 caggagtcgc ataagggaga gcgtcgagat cccggacacc atcgaatggc gcaaaacctt

     7081 tcgcggtatg gcatgatagc gcccggaaga gagtcaattc agggtggtga atgtgaaacc

     7141 agtaacgtta tacgatgtcg cagagtatgc cggtgtctct tatcagaccg tttcccgcgt

     7201 ggtgaaccag gccagccacg tttctgcgaa aacgcgggaa aaagtggaag cggcgatggc

     7261 ggagctgaat tacattccca accgcgtggc acaacaactg gcgggcaaac agtcgttgct

     7321 gattggcgtt gccacctcca gtctggccct gcacgcgccg tcgcaaattg tcgcggcgat

     7381 taaatctcgc gccgatcaac tgggtgccag cgtggtggtg tcgatggtag aacgaagcgg

     7441 cgtcgaagcc tgtaaagcgg cggtgcacaa tcttctcgcg caacgcgtca gtgggctgat

     7501 cattaactat ccgctggatg accaggatgc cattgctgtg gaagctgcct gcactaatgt

     7561 tccggcgtta tttcttgatg tctctgacca gacacccatc aacagtatta ttttctccca

     7621 tgaagacggt acgcgactgg gcgtggagca tctggtcgca ttgggtcacc agcaaatcgc

     7681 gctgttagcg ggcccattaa gttctgtctc ggcgcgtctg cgtctggctg gctggcataa

     7741 atatctcact cgcaatcaaa ttcagccgat agcggaacgg gaaggcgact ggagtgccat

     7801 gtccggtttt caacaaacca tgcaaatgct gaatgagggc atcgttccca ctgcgatgct

     7861 ggttgccaac gatcagatgg cgctgggcgc aatgcgcgcc attaccgagt ccgggctgcg

     7921 cgttggtgcg gatatctcgg tagtgggata cgacgatacc gaagacagct catgttatat

     7981 cccgccgtta accaccatca aacaggattt tcgcctgctg gggcaaacca gcgtggaccg

     8041 cttgctgcaa ctctctcagg gccaggcggt gaagggcaat cagctgttgc ccgtctcact

     8101 ggtgaaaaga aaaaccaccc tggcgcccaa tacgcaaacc gcctctcccc gcgcgttggc

     8161 cgattcatta atgcagctgg cacgacaggt ttcccgactg gaaagcgggc agtgagcgca

     8221 acgcaattaa tgtaagttag ctcactcatt aggcaccggg atctcgaccg atgcccttga

     8281 gagccttcaa cccagtcagc tccttccggt gggcgcgggg catgactatc gtcgccgcac

     8341 ttatgactgt cttctttatc atgcaactcg taggacaggt gccggcagcg ctctgggtca

     8401 ttttcggcga ggaccgcttt cgctggagcg cgacgatgat cggcctgtcg cttgcggtat

     8461 tcggaatctt gcacgccctc gctcaagcct tcgtcactgg tcccgccacc aaacgtttcg

     8521 gcgagaagca ggccattatc gccggcatgg cggccgacgc gctgggctac gtcttgctgg

     8581 cgttcgcgac gcgaggctgg atggccttcc ccattatgat tcttctcgct tccggcggca

     8641 tcgggatgcc cgcgttgcag gccatgctgt ccaggcaggt agatgacgac catcagggac

     8701 agcttcaagg atcgctcgcg gctcttacca gcctaacttc gatcattgga ccgctgatcg

     8761 tcacggcgat ttatgccgcc tcggcgagca catggaacgg gttggcatgg attgtaggcg

     8821 ccgccctata ccttgtctgc ctccccgcgt tgcgtcgcgg tgcatggagc cgggccacct

     8881 cgacctgaat ggaagccggc ggcacctcgc taacggattc accactccaa gaattggagc

     8941 caatcaattc ttgcggagaa ctgtgaatgc gcaaaccaac ccttggcaga acatatccat

     9001 cgcgtccgcc atctccagca gccgcacgcg gcgcatctcg ggcagcgttg ggtcctggcc

     9061 acgggtgcgc atgatcgtgc tcctgtcgtt gaggacccgg ctaggctggc ggggttgcct

     9121 tactggttag cagaatgaat caccgatacg cgagcgaacg tgaagcgact gctgctgcaa

     9181 aacgtctgcg acctgagcaa caacatgaat ggtcttcggt ttccgtgttt cgtaaagtct

     9241 ggaaacgcgg aagtcagcgc cctgcaccat tatgttccgg atctgcatcg caggatgctg

     9301 ctggctaccc tgtggaacac ctacatctgt attaacgaag cgctggcatt gaccctgagt

     9361 gatttttctc tggtcccgcc gcatccatac cgccagttgt ttaccctcac aacgttccag

     9421 taaccgggca tgttcatcat cagtaacccg tatcgtgagc atcctctctc gtttcatcgg

     9481 tatcattacc cccatgaaca gaaatccccc ttacacggag gcatcagtga ccaaacagga

     9541 aa

//

No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart