pCAG- IRES- Puro

$160.00

  • Model: PVT10733
  • 50 Units in Stock
Ask a question


Add to Cart:

pCAG-IRES-Puro

Catalog No. PVT10733
Packing 2ug

 

pCAG-IRES-Puro information
Function Mammal expression plasmid
Resistance Amp
Screen Puro
Strain DH5alpha
Culture temperature 37degrees centigrade
Replicon pUC
Copy high
Promoter CAG
Induction --
Forward primer
Reverse primer

 

pCAG-IRES-Puro Description

PCAG-IRES-Puro is a pCAG expression plasmid of mammalian cells.

pCAG-IRES-Puro-vector

 

pCAG-IRES-Puro Sequence

LOCUS       Exported                6034 bp ds-DNA     circular SYN 21-NOV-2017

DEFINITION  synthetic circular DNA

FEATURES             Location/Qualifiers

     source          1..6034

                     /organism="synthetic DNA construct"

                     /mol_type="other DNA"

     misc_feature    4..1674

                     /label=CAG promoter

     misc_feature    1766..2339

                     /label=IRES

                     /note="internal ribosome entry site (IRES) of the 

                     encephalomyocarditis virus (EMCV)"

     CDS             2372..2971

                     /codon_start=1

                     /gene="pac from Streptomyces alboniger"

                     /product="puromycin N-acetyltransferase"

                     /label=PuroR

                     /note="confers resistance to puromycin"

                     /translation="MTEYKPTVRLATRDDVPRAVRTLAAAFADYPATRHTVDPDRHIER

                     VTELQELFLTRVGLDIGKVWVADDGAAVAVWTTPESVEAGAVFAEIGPRMAELSGSRLA

                     AQQQMEGLLAPHRPKEPAWFLATVGVSPDHQGKGLGSAVVLPGVEAAERAGVPAFLETS

                     APRNLPFYERLGFTVTADVEVPEGPRTWCMTRKPGA"

     polyA_site      3122..3177

                     /label=-beta-globin poly(A) signal

                     /note="rabbit beta-globin polyadenylation signal"

     promoter        3710..3905

                     /label=SV40 promoter

                     /note="SV40 early promoter"

     rep_origin      3756..3891

                     /label=SV40 ori

                     /note="SV40 origin of replication"

     polyA_signal    3911..4045

                     /label=SV40 poly(A) signal

                     /note="SV40 polyadenylation signal"

     rep_origin      complement(4284..4872)

                     /direction=LEFT

                     /label=ori

                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 

                     replication"

     CDS             complement(5043..5903)

                     /codon_start=1

                     /gene="bla"

                     /product="beta-lactamase"

                     /label=AmpR

                     /note="confers resistance to ampicillin, carbenicillin, and

                     related antibiotics"

                     /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI

                     ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVEYS

                     PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW

                     EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA

                     LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS

                     LIKHW"

     promoter        complement(5904..6008)

                     /gene="bla"

                     /label=AmpR promoter

ORIGIN

        1 gtcgacattg attattgact agttattaat agtaatcaat tacggggtca ttagttcata

       61 gcccatatat ggagttccgc gttacataac ttacggtaaa tggcccgcct ggctgaccgc

      121 ccaacgaccc ccgcccattg acgtcaataa tgacgtatgt tcccatagta acgccaatag

      181 ggactttcca ttgacgtcaa tgggtggact atttacggta aactgcccac ttggcagtac

      241 atcaagtgta tcatatgcca agtacgcccc ctattgacgt caatgacggt aaatggcccg

      301 cctggcatta tgcccagtac atgaccttat gggactttcc tacttggcag tacatctacg

      361 tattagtcat cgctattacc atgggtcgag gtgagcccca cgttctgctt cactctcccc

      421 atctcccccc cctccccacc cccaattttg tatttattta ttttttaatt attttgtgca

      481 gcgatggggg cggggggggg gggggcgcgc gccaggcggg gcggggcggg gcgaggggcg

      541 gggcggggcg aggcggagag gtgcggcggc agccaatcag agcggcgcgc tccgaaagtt

      601 tccttttatg gcgaggcggc ggcggcggcg gccctataaa aagcgaagcg cgcggcgggc

      661 gggagtcgct gcgttgcctt cgccccgtgc cccgctccgc gccgcctcgc gccgcccgcc

      721 ccggctctga ctgaccgcgt tactcccaca ggtgagcggg cgggacggcc cttctcctcc

      781 gggctgtaat tagcgcttgg tttaatgacg gctcgtttct tttctgtggc tgcgtgaaag

      841 ccttaaaggg ctccgggagg gccctttgtg cgggggggag cggctcgggg ggtgcgtgcg

      901 tgtgtgtgtg cgtggggagc gccgcgtgcg gcccgcgctg cccggcggct gtgagcgctg

      961 cgggcgcggc gcggggcttt gtgcgctccg cgtgtgcgcg aggggagcgc ggccgggggc

     1021 ggtgccccgc ggtgcggggg ggctgcgagg ggaacaaagg ctgcgtgcgg ggtgtgtgcg

     1081 tgggggggtg agcagggggt gtgggcgcgg cggtcgggct gtaacccccc cctgcacccc

     1141 cctccccgag ttgctgagca cggcccggct tcgggtgcgg ggctccgtgc ggggcgtggc

     1201 gcggggctcg ccgtgccggg cggggggtgg cggcaggtgg gggtgccggg cggggcgggg

     1261 ccgcctcggg ccggggaggg ctcgggggag gggcgcggcg gcccccggag cgccggcggc

     1321 tgtcgaggcg cggcgagccg cagccattgc cttttatggt aatcgtgcga gagggcgcag

     1381 ggacttcctt tgtcccaaat ctgtgcggag ccgaaatctg ggaggcgccg ccgcaccccc

     1441 tctagcgggc gcggggcgaa gcggtgcggc gccggcagga aggaaatggg cggggagggc

     1501 cttcgtgcgt cgccgcgccg ccgtcccctt ctccctctcc agcctcgggg ctgtccgcgg

     1561 ggggacggct gccttcgggg gggacggggc agggcggggt tcggcttctg gcgtgtgacc

     1621 ggcggctcta gagcctctgc taaccatgtt catgccttct tctttttcct acagctcctg

     1681 ggcaacgtgc tggttattgt gctgtctcat cattttggca aagaattctg cagtcgacgg

     1741 taccgcgggc ccgggatcca ccggtcccct ctccctcccc cccccctaac gttactggcc

     1801 gaagccgctt ggaataaggc cggtgtgcgt ttgtctatat gttattttcc accatattgc

     1861 cgtcttttgg caatgtgagg gcccggaaac ctggccctgt cttcttgacg agcattccta

     1921 ggggtctttc ccctctcgcc aaaggaatgc aaggtctgtt gaatgtcgtg aaggaagcag

     1981 ttcctctgga agcttcttga agacaaacaa cgtctgtagc gaccctttgc aggcagcgga

     2041 accccccacc tggcgacagg tgcctctgcg gccaaaagcc acgtgtataa gatacacctg

     2101 caaaggcggc acaaccccag tgccacgttg tgagttggat agttgtggaa agagtcaaat

     2161 ggctctcctc aagcgtattc aacaaggggc tgaaggatgc ccagaaggta ccccattgta

     2221 tgggatctga tctggggcct cggtgcacat gctttacatg tgtttagtcg aggttaaaaa

     2281 aacgtctagg ccccccgaac cacggggacg tggttttcct ttgaaaaaca cgatgataag

     2341 cttgccacaa cccacaagga gacgaccttc catgaccgag tacaagccca cggtgcgcct

     2401 cgccacccgc gacgacgtcc cccgggccgt acgcaccctc gccgccgcgt tcgccgacta

     2461 ccccgccacg cgccacaccg tcgacccgga ccgccacatc gagcgggtca ccgagctgca

     2521 agaactcttc ctcacgcgcg tcgggctcga catcggcaag gtgtgggtcg cggacgacgg

     2581 cgccgcggtg gcggtctgga ccacgccgga gagcgtcgaa gcgggggcgg tgttcgccga

     2641 gatcggcccg cgcatggccg agttgagcgg ttcccggctg gccgcgcagc aacagatgga

     2701 aggcctcctg gcgccgcacc ggcccaagga gcccgcgtgg ttcctggcca ccgtcggcgt

     2761 ctcgcccgac caccagggca agggtctggg cagcgccgtc gtgctccccg gagtggaggc

     2821 ggccgagcgc gccggggtgc ccgccttcct ggagacctcc gcgccccgca acctcccctt

     2881 ctacgagcgg ctcggcttca ccgtcaccgc cgacgtcgag gtgcccgaag gaccgcgcac

     2941 ctggtgcatg acccgcaagc ccggtgccta ggcggccgca ctcctcaggt gcaggctgcc

     3001 tatcagaagg tggtggctgg tgtggccaat gccctggctc acaaatacca ctgagatctt

     3061 tttccctctg ccaaaaatta tggggacatc atgaagcccc ttgagcatct gacttctggc

     3121 taataaagga aatttatttt cattgcaata gtgtgttgga attttttgtg tctctcactc

     3181 ggaaggacat atgggagggc aaatcattta aaacatcaga atgagtattt ggtttagagt

     3241 ttggcaacat atgcccatat gctggctgcc atgaacaaag gtggctataa agaggtcatc

     3301 agtatatgaa acagccccct gctgtccatt ccttattcca tagaaaagcc ttgacttgag

     3361 gttagatttt ttttatattt tgttttgtgt tatttttttc tttaacatcc ctaaaatttt

     3421 ccttacatgt tttactagcc agatttttcc tcctctcctg actactccca gtcatagctg

     3481 tccctcttct cttatgaaga tccctcgacc tgcagcccaa gcttggcgta atcatggtca

     3541 tagctgtttc ctgtgtgaaa ttgttatccg ctcacaattc cacacaacat acgagccgga

     3601 agcataaagt gtaaagcctg gggtgcctaa tgagtgagct aactcacatt aattgcgttg

     3661 cgctcactgc ccgctttcca gtcgggaaac ctgtcgtgcc agcggatccg catctcaatt

     3721 agtcagcaac catagtcccg cccctaactc cgcccatccc gcccctaact ccgcccagtt

     3781 ccgcccattc tccgccccat ggctgactaa ttttttttat ttatgcagag gccgaggccg

     3841 cctcggcctc tgagctattc cagaagtagt gaggaggctt ttttggaggc ctaggctttt

     3901 gcaaaaagct aacttgttta ttgcagctta taatggttac aaataaagca atagcatcac

     3961 aaatttcaca aataaagcat ttttttcact gcattctagt tgtggtttgt ccaaactcat

     4021 caatgtatct tatcatgtct ggatccgctg cattaatgaa tcggccaacg cgcggggaga

     4081 ggcggtttgc gtattgggcg ctcttccgct tcctcgctca ctgactcgct gcgctcggtc

     4141 gttcggctgc ggcgagcggt atcagctcac tcaaaggcgg taatacggtt atccacagaa

     4201 tcaggggata acgcaggaaa gaacatgtga gcaaaaggcc agcaaaaggc caggaaccgt

     4261 aaaaaggccg cgttgctggc gtttttccat aggctccgcc cccctgacga gcatcacaaa

     4321 aatcgacgct caagtcagag gtggcgaaac ccgacaggac tataaagata ccaggcgttt

     4381 ccccctggaa gctccctcgt gcgctctcct gttccgaccc tgccgcttac cggatacctg

     4441 tccgcctttc tcccttcggg aagcgtggcg ctttctcaat gctcacgctg taggtatctc

     4501 agttcggtgt aggtcgttcg ctccaagctg ggctgtgtgc acgaaccccc cgttcagccc

     4561 gaccgctgcg ccttatccgg taactatcgt cttgagtcca acccggtaag acacgactta

     4621 tcgccactgg cagcagccac tggtaacagg attagcagag cgaggtatgt aggcggtgct

     4681 acagagttct tgaagtggtg gcctaactac ggctacacta gaaggacagt atttggtatc

     4741 tgcgctctgc tgaagccagt taccttcgga aaaagagttg gtagctcttg atccggcaaa

     4801 caaaccaccg ctggtagcgg tggttttttt gtttgcaagc agcagattac gcgcagaaaa

     4861 aaaggatctc aagaagatcc tttgatcttt tctacggggt ctgacgctca gtggaacgaa

     4921 aactcacgtt aagggatttt ggtcatgaga ttatcaaaaa ggatcttcac ctagatcctt

     4981 ttaaattaaa aatgaagttt taaatcaatc taaagtatat atgagtaaac ttggtctgac

     5041 agttaccaat gcttaatcag tgaggcacct atctcagcga tctgtctatt tcgttcatcc

     5101 atagttgcct gactccccgt cgtgtagata actacgatac gggagggctt accatctggc

     5161 cccagtgctg caatgatacc gcgagaccca cgctcaccgg ctccagattt atcagcaata

     5221 aaccagccag ccggaagggc cgagcgcaga agtggtcctg caactttatc cgcctccatc

     5281 cagtctatta attgttgccg ggaagctaga gtaagtagtt cgccagttaa tagtttgcgc

     5341 aacgttgttg ccattgctac aggcatcgtg gtgtcacgct cgtcgtttgg tatggcttca

     5401 ttcagctccg gttcccaacg atcaaggcga gttacatgat cccccatgtt gtgcaaaaaa

     5461 gcggttagct ccttcggtcc tccgatcgtt gtcagaagta agttggccgc agtgttatca

     5521 ctcatggtta tggcagcact gcataattct cttactgtca tgccatccgt aagatgcttt

     5581 tctgtgactg gtgagtactc aaccaagtca ttctgagaat agtgtatgcg gcgaccgagt

     5641 tgctcttgcc cggcgtcaat acgggataat accgcgccac atagcagaac tttaaaagtg

     5701 ctcatcattg gaaaacgttc ttcggggcga aaactctcaa ggatcttacc gctgttgaga

     5761 tccagttcga tgtaacccac tcgtgcaccc aactgatctt cagcatcttt tactttcacc

     5821 agcgtttctg ggtgagcaaa aacaggaagg caaaatgccg caaaaaaggg aataagggcg

     5881 acacggaaat gttgaatact catactcttc ctttttcaat attattgaag catttatcag

     5941 ggttattgtc tcatgagcgg atacatattt gaatgtattt agaaaaataa acaaataggg

     6001 gttccgcgca catttccccg aaaagtgcca cctg

//

 

Caution:
Product is for research use only!

No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart