pCAGGS- Myc

$160.00

  • Model: PVT10729
  • 50 Units in Stock
Ask a question


Add to Cart:

pCAGGS-Myc


PVT10729  2ug
 

pCAGGS-Myc Information

Promoter: CAG promoter

Replicon: Ori, SV40 ori

Terminator: beta -globin poly (A) signal

Plasmid classification: lactation cell plasmid; lactation expression plasmid; pCAG series plasmid.

Plasmid size: 4809bp

Plasmid tagging: N-Myc

Prokaryotic resistance: ampicillin Amp

Clone strain: Escherichia coli DH5 alpha

Culture conditions: 37 C, aerobic, LB

Expression host: mammalian cells such as 293T

 

pCAGGS-Myc Descrption

pCAGGS-Myc is a mammalian eukaryotic expression plasmid. The CAG promoter drives the fusion expression of Myc tags and target genes.

 

 

pCAGGS-Myc Sequence

LOCUS       Exported                4809 bp ds-DNA     circular SYN 17-AUG-2017

DEFINITION  synthetic circular DNA

KEYWORDS    pCAGGS-Myc.dna

SOURCE      synthetic DNA construct

  ORGANISM  synthetic DNA construct

REFERENCE   1  (bases 1 to 4809)

FEATURES             Location/Qualifiers

     source          1..4809

                     /organism="synthetic DNA construct"

                     /mol_type="other DNA"

     regulatory      1..10

                     /regulatory_class="other"

                     /note="vertebrate consensus sequence for strong initiation 

                     of translation (Kozak, 1987)"

     CDS             10..39

                     /codon_start=1

                     /product="Myc (human c-Myc oncogene) epitope tag"

                     /label=Myc

                     /translation="EQKLISEEDL"

     polyA_site      169..224

                     /label=-beta-globin poly(A) signal

                     /note="rabbit beta-globin polyadenylation signal"

     promoter        757..952

                     /label=SV40 promoter

                     /note="SV40 early promoter"

     rep_origin      803..938

                     /label=SV40 ori

                     /note="SV40 origin of replication"

     polyA_signal    958..1092

                     /label=SV40 poly(A) signal

                     /note="SV40 polyadenylation signal"

     rep_origin      complement(1330..1918)

                     /direction=LEFT

                     /label=ori

                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 

                     replication"

     CDS             complement(2089..2949)

                     /codon_start=1

                     /gene="bla"

                     /product="beta-lactamase"

                     /label=AmpR

                     /note="confers resistance to ampicillin, carbenicillin, and

                     related antibiotics"

                     /translation="[TEM beta-lactamase fragment, 45 aa]

                     ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVEYS

                     [TEM beta-lactamase fragment, 59 aa]

                     EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA

                     [TEM beta-lactamase fragment, 59 aa]

                     LIKHW"

     promoter        complement(2950..3054)

                     /gene="bla"

                     /label=AmpR promoter

     enhancer        3085..3464

                     /label=CMV enhancer

                     /note="human cytomegalovirus immediate early enhancer"

     promoter        3466..3743

                     /label=chicken beta-actin promoter

     intron          3744..4761

                     /label=chimeric intron

                     /note="chimera between introns from chicken beta-actin and 

                     rabbit beta-globin"

ORIGIN

        1 gccaccatgg aacaaaaact catctcagaa gaggatctgg aattcgagct catcgatggt

       61 acccgggcat gcctcgagct agcagatctt aattaattaa ggatcttttt ccctctgcca

      121 aaaattatgg ggacatcatg aagccccttg agcatctgac ttctggctaa taaaggaaat

      181 ttattttcat tgcaatagtg tgttggaatt ttttgtgtct ctcactcgga aggacatatg

      241 ggagggcaaa tcatttaaaa catcagaatg agtatttggt ttagagtttg gcaacatatg

      301 cccatatgct ggctgccatg aacaaaggtt ggctataaag aggtcatcag tatatgaaac

      361 agccccctgc tgtccattcc ttattccata gaaaagcctt gacttgaggt tagatttttt

      421 ttatattttg ttttgtgtta tttttttctt taacatccct aaaattttcc ttacatgttt

      481 tactagccag atttttcctc ctctcctgac tactcccagt catagctgtc cctcttctct

      541 tatggagatc cctcgacctg cagcccaagc ttggcgtaat catggtcata gctgtttcct

      601 gtgtgaaatt gttatccgct cacaattcca cacaacatac gagccggaag cataaagtgt

      661 aaagcctggg tgcctaatga gtgagctaac tcacattaat tgcgttgcgc tcactgcccg

      721 ctttccagtc gggaaacctg tcgtgccagc ggatccgcat ctcaattagt cagcaaccat

      781 agtcccgccc ctaactccgc ccatcccgcc cctaactccg cccagttccg cccattctcc

      841 gccccatggc tgactaattt tttttattta tgcagaggcc gaggccgcct cggcctctga

      901 gctattccag aagtagtgag gaggcttttt tggaggccta ggcttttgca aaaagctaac

      961 ttgtttattg cagcttataa tggttacaaa taaagcaata gcatcacaaa tttcacaaat

     1021 aaagcatttt tttcactgca ttctagttgt ggtttgtcca aactcatcaa tgtatcttat

     1081 catgtctgga tccgctgcat taatgaatcg gccaacgcgc ggggagaggc ggtttgcgta

     1141 ttgggcgctc ttccgcttcc tcgctcactg actcgctgcg ctcggtcgtt cggctgcggc

     1201 gagcggtatc agctcactca aaggcggtaa tacggttatc cacagaatca gggataacgc

     1261 aggaaagaac atgtgagcaa aaggccagca aaaggccagg aaccgtaaaa aggccgcgtt

     1321 gctggcgttt ttccataggc tccgcccccc tgacgagcat cacaaaaatc gacgctcaag

     1381 tcagaggtgg cgaaacccga caggactata aagataccag gcgtttcccc ctggaagctc

     1441 cctcgtgcgc tctcctgttc cgaccctgcc gcttaccgga tacctgtccg cctttctccc

     1501 ttcgggaagc gtggcgcttt ctcatagctc acgctgtagg tatctcagtt cggtgtaggt

     1561 cgttcgctcc aagctgggct gtgtgcacga accccccgtt cagcccgacc gctgcgcctt

     1621 atccggtaac tatcgtcttg agtccaaccc ggtaagacac gacttatcgc cactggcagc

     1681 agccactggt aacaggatta gcagagcgag gtatgtaggc ggtgctacag agttcttgaa

     1741 gtggtggcct aactacggct acactagaag aacagtattt ggtatctgcg ctctgctgaa

     1801 gccagttacc ttcggaaaaa gagttggtag ctcttgatcc ggcaaacaaa ccaccgctgg

     1861 tagcggtggt ttttttgttt gcaagcagca gattacgcgc agaaaaaaag gatctcaaga

     1921 agatcctttg atcttttcta cggggtctga cgctcagtgg aacgaaaact cacgttaagg

     1981 gattttggtc atgagattat caaaaaggat cttcacctag atccttttaa attaaaaatg

     2041 aagttttaaa tcaatctaaa gtatatatga gtaaacttgg tctgacagtt accaatgctt

     2101 aatcagtgag gcacctatct cagcgatctg tctatttcgt tcatccatag ttgcctgact

     2161 ccccgtcgtg tagataacta cgatacggga gggcttacca tctggcccca gtgctgcaat

     2221 gataccgcga gacccacgct caccggctcc agatttatca gcaataaacc agccagccgg

     2281 aagggccgag cgcagaagtg gtcctgcaac tttatccgcc tccatccagt ctattaattg

     2341 ttgccgggaa gctagagtaa gtagttcgcc agttaatagt ttgcgcaacg ttgttgccat

     2401 tgctacaggc atcgtggtgt cacgctcgtc gtttggtatg gcttcattca gctccggttc

     2461 ccaacgatca aggcgagtta catgatcccc catgttgtgc aaaaaagcgg ttagctcctt

     2521 cggtcctccg atcgttgtca gaagtaagtt ggccgcagtg ttatcactca tggttatggc

     2581 agcactgcat aattctctta ctgtcatgcc atccgtaaga tgcttttctg tgactggtga

     2641 gtactcaacc aagtcattct gagaatagtg tatgcggcga ccgagttgct cttgcccggc

     2701 gtcaatacgg gataataccg cgccacatag cagaacttta aaagtgctca tcattggaaa

     2761 acgttcttcg gggcgaaaac tctcaaggat cttaccgctg ttgagatcca gttcgatgta

     2821 acccactcgt gcacccaact gatcttcagc atcttttact ttcaccagcg tttctgggtg

     2881 agcaaaaaca ggaaggcaaa atgccgcaaa aaagggaata agggcgacac ggaaatgttg

     2941 aatactcata ctcttccttt ttcaatatta ttgaagcatt tatcagggtt attgtctcat

     3001 gagcggatac atatttgaat gtatttagaa aaataaacaa ataggggttc cgcgcacatt

     3061 tccccgaaaa gtgccacctg ggtcgacatt gattattgac tagttattaa tagtaatcaa

     3121 ttacggggtc attagttcat agcccatata tggagttccg cgttacataa cttacggtaa

     3181 atggcccgcc tggctgaccg cccaacgacc cccgcccatt gacgtcaata atgacgtatg

     3241 ttcccatagt aacgccaata gggactttcc attgacgtca atgggtggag tatttacggt

     3301 aaactgccca cttggcagta catcaagtgt atcatatgcc aagtacgccc cctattgacg

     3361 tcaatgacgg taaatggccc gcctggcatt atgcccagta catgacctta tgggactttc

     3421 ctacttggca gtacatctac gtattagtca tcgctattac catggtcgag gtgagcccca

     3481 cgttctgctt cactctcccc atctcccccc cctccccacc cccaattttg tatttattta

     3541 ttttttaatt attttgtgca gcgatggggg cggggggggg gggggggccc cccccaggcg

     3601 gggcggggcg gggcgagggg cggggcgggg cgaggcggaa aggtgcggcg gcagccaatc

     3661 agagcggcgc gctccgaaag tttcctttta tggcgaggcg gcggcggcgg cggccctata

     3721 aaaagcgaag cgcgcggcgg gcgggagtcg ttgcgcgctg ccttcccccc gtgccccgct

     3781 ccgccgccgc ctcgcgccgc ccgccccggc tctgactgac cgcgttactc ccacaggtga

     3841 gcgggcggga cggcccttct cctccgggct gtaattagcg cttggtttaa tgacggcttg

     3901 tttcttttct gtggctgcgt gaaagccttg aggggctccg ggagggccct ttgtgcgggg

     3961 ggagcggctc ggggggtgcg tgcgtgtgtg tgtgcgtggg gagcgccgcg tgcggctccg

     4021 cgctgcccgg cggctgtgag cgctgcgggc gcggcgcggg gctttgtgcg ctccgcagtg

     4081 tgcgcgaggg gagcgcggcc gggggcggtg ccccgcggtg cggggggggc tgcgagggga

     4141 acaaaggctg cgtgcggggt gtgtgcgtgg gggggtgagc agggggtgtg ggcgcgtcgg

     4201 tcgggctgca accccccctg cacccccctc cccgagttgc tgagcacggc ccggcttcgg

     4261 gtgcggggct ccgtacgggg cgtggcgcgg ggctcgccgt gccgggcggg gggtggcggc

     4321 aggtgggggt gccgggcggg gcggggccgc ctcgggccgg ggagggctcg ggggaagggg

     4381 cgcggcggcc cccggagcgc cggcggctgt cgaggcgcgg cgagccgcag ccattgcctt

     4441 ttatggtaat cgtgcgagag ggcgcaggga cttcctttgt cccaaatctg tgcggagccg

     4501 aaatctggga ggcgccgccg caccccctct agcgggcgcg gggcgaagcg gtgcggcgcc

     4561 ggcaggaagg aaatgggcgg ggagggcctt cgtgcgtcgc cgcgccgccg tccccttctc

     4621 cctctccagc ctcggggctg tccgcggggg gacggctgcc ttcggggggg acggggcagg

     4681 gcggggttcg gcttctggcg tgtgaccggc ggctctagag cctctgctaa ccatgttcat

     4741 gccttcttct ttttcctaca gctcctgggc aacgtgctgg ttattgtgct gtctcatcat

     4801 tttggcaaa

//

 

Caution:
Product is for research use only!

No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart