pCAMBIA1301

$236.00

  • Model: PVT3013
  • 50 Units in Stock
Ask a question


Add to Cart:

pCAMBIA1301

PVT3013       2ug
 

 

pCAMBIA1301 Informaiton

Promoter: Lac, CaMV 35S

Replicon: pVS1 oriV, ori

Plasmid classification: plant series, protein overexpression vector

Plasmid size: 11849bp

Prokaryotic resistance: Kan

Selection marker: Hyg

Clonal strain: DH5 alpha

Culture conditions: 37 C, aerobic LB

Expression host: plant cells

5'sequencing primers: M13F:TGTAAAACGACGGCCAGT

Primers for 3'sequencing: primers designed based on sequences

 

pCAMBIA1301 Description

This vector contains a fully functional gusA reporter construct for simple and sensitive analysis of gene function or presence in regenerated plants by GUS assay. The construct uses E.coli gusA with an intron (from the castor bean catalase gene) inside the coding sequence to ensure that expression of glucuronidase activity is derived from eukaryotic cells, not from expression by residual A.tumefaciens cells. This vector is suitable for insertion of other genes of interest containing their own promoter and terminator. Researchers can excise the gusA gene and insert their own gene of interest in its place or use these vectors to create fusions of gusA with their gene of interest. These vectors contain the pUC18 polylinker-lacZa.

 

pCAMBIA1301 Multiple cloning site

pCAMBIA1301-vector

 

pCAMBIA1301 Sequence

LOCUS       Exported               11849 bp ds-DNA     circular SYN 13-SEP-2016

DEFINITION  synthetic circular DNA

KEYWORDS    Untitled 8

SOURCE      synthetic DNA construct

  ORGANISM  synthetic DNA construct

REFERENCE   1  (bases 1 to 11849)

  AUTHORS   .

  TITLE     Direct Submission

FEATURES             Location/Qualifiers

     source          1..11849

                     /organism="synthetic DNA construct"

                     /mol_type="other DNA"

     intron          10..199

                     /note="cat1 intron"

                     /note="castor bean catalase intron, modified"

     CDS             2024..2041

                     /codon_start=1

                     /product="6xHis affinity tag"

                     /note="6xHis"

                     /translation="HHHHHH"

     terminator      2076..2328

                     /note="NOS terminator"

                     /note="nopaline synthase terminator and poly(A) signal"

     misc_feature    2350..2374

                     /note="RB T-DNA repeat"

                     /note="right border repeat from nopaline C58 T-DNA"

     CDS             3674..4303

                     /codon_start=1

                     /product="stability protein from the Pseudomonas plasmid 

                     pVS1 (Heeb et al., 2000)"

                     /note="pVS1 StaA"

                     /translation="MKVIAVLNQKGGSGKTTIATHLARALQLAGADVLLVDSDPQGSAR

                     DWAAVREDQPLTVVGIDRPTIDRDVKAIGRRDFVVIDGAPQAADLAVSAIKAADFVLIP

                     VQPSPYDIWATADLVELVKQRIEVTDGRLQAAFVVSRAIKGTRIGGEVAEALAGYELPI

                     LESRITQRVSYPGTAAAGTTVLESEPEGDAAREVQALAAEIKSKLI"

     CDS             4737..5804

                     /codon_start=1

                     /product="replication protein from the Pseudomonas plasmid 

                     pVS1 (Heeb et al., 2000)"

                     /note="pVS1 RepA"

                     /translation="GRKPSGPVQIGAALGDDLVEKLKAAQAAQRQRIEAEARPGESWQA

                     AADRIRKESRQPPAAGAPSIRKPPKGDEQPDFFVPMLYDVGTRDSRSIMDVAVFRLSKR

                     DRRAGEVIRYELPDGHVEVSAGPAGMASVWDYDLVLMAVSHLTESMNRYREGKGDKPGR

                     VFRPHVADVLKFCRRADGGKQKDDLVETCIRLNTTHVAMQRTKKAKNGRLVTVSEGEAL

                     ISRYKIVKSETGRPEYIEIELADWMYREITEGKNPDVLTVHPDYFLIDPGIGRFLYRLA

                     RRAAGKAEARWLFKTIYERSGSAGEFKKFCFTVRKLIGSNDLPEYDLKEEAGQAGPILV

                     MRYRNLIEGEASAGS"

     rep_origin      5870..6064

                     /note="pVS1 oriV"

                     /note="origin of replication for the Pseudomonas plasmid 

                     pVS1 (Heeb et al., 2000)"

     misc_feature    6408..6548

                     /note="bom"

                     /note="basis of mobility region from pBR322"

     rep_origin      complement(6734..7322)

                     /direction=LEFT

                     /note="ori"

                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 

                     replication"

     CDS             complement(7409..8203)

                     /codon_start=1

                     /gene="aphA-3"

                     /product="aminoglycoside phosphotransferase"

                     /note="KanR"

                     /note="confers resistance to kanamycin"

                     /translation="MAKMRISPELKKLIEKYRCVKDTEGMSPAKVYKLVGENENLYLKM

                     TDSRYKGTTYDVEREKDMMLWLEGKLPVPKVLHFERHDGWSNLLMSEADGVLCSEEYED

                     EQSPEKIIELYAECIRLFHSIDISDCPYTNSLDSRLAELDYLLNNDLADVDCENWEEDT

                     PFKDPRELYDFLKTEKPEEELVFSHGDLGDSNIFVKDGKVSGFIDLGRSGRADKWYDIA

                     FCVRSIREDIGEEQYVELFFDLLGIKPDWEKIKYYILLDELF"

     misc_feature    8628..8652

                     /note="LB T-DNA repeat"

                     /note="left border repeat from nopaline C58 T-DNA"

     polyA_signal    8730..8904

                     /note="CaMV poly(A) signal"

                     /note="cauliflower mosaic virus polyadenylation signal"

     CDS             complement(8944..9969)

                     /codon_start=1

                     /gene="aph(4)-Ia"

                     /product="aminoglycoside phosphotransferase from E. coli"

                     /note="HygR"

                     /note="confers resistance to hygromycin"

                     /translation="MKKPELTATSVEKFLIEKFDSVSDLMQLSEGEESRAFSFDVGGRG

                     YVLRVNSCADGFYKDRYVYRHFASAALPIPEVLDIGEFSESLTYCISRRAQGVTLQDLP

                     ETELPAVLQPVAEAMDAIAAADLSQTSGFGPFGPQGIGQYTTWRDFICAIADPHVYHWQ

                     TVMDDTVSASVAQALDELMLWAEDCPEVRHLVHADFGSNNVLTDNGRITAVIDWSEAMF

                     GDSQYEVANIFFWRPWLACMEQQTRYFERRHPELAGSPRLRAYMLRIGLDQLYQSLVDG

                     NFDDAAWAQGRCDAIVRSGAGTVGRTQIARRSAAVWTDGCVEVLADSGNRRPSTRPRAK

                     K"

     promoter        complement(10037..10714)

                     /note="CaMV 35S promoter (enhanced)"

                     /note="cauliflower mosaic virus 35S promoter with a 

                     duplicated enhancer region"

     protein_bind    10905..10926

                     /bound_moiety="E. coli catabolite activator protein"

                     /note="CAP binding site"

                     /note="CAP binding activates transcription in the presence 

                     of cAMP."

     promoter        10941..10971

                     /note="lac promoter"

                     /note="promoter for the E. coli lac operon"

     protein_bind    10979..10995

                     /bound_moiety="lac repressor encoded by lacI"

                     /note="lac operator"

                     /note="The lac repressor binds to the lac operator to 

                     inhibit transcription in E. coli. This inhibition can be 

                     relieved by adding lactose or 

                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."

     primer_bind     11003..11019

                     /note="M13 rev"

                     /note="common sequencing primer, one of multiple similar 

                     variants"

     CDS             11015..11248

                     /codon_start=1

                     /gene="lacZ fragment"

                     /product="LacZ-alpha fragment of beta-galactosidase"

                     /note="lacZ-alpha"

                     /translation="MTMITNSSSVPGDPLESTCRHASLALAVVLQRRDWENPGVTQLNR

                     LAAHPPFASWRNSEEARTDRPSQQLRSLNGEC"

     misc_feature    11029..11085

                     /note="MCS"

                     /note="pUC18/19 multiple cloning site"

     primer_bind     complement(11089..11105)

                     /note="M13 fwd"

                     /note="common sequencing primer, one of multiple similar 

                     variants"

     promoter        11482..11827

                     /note="CaMV 35S promoter"

                     /note="strong constitutive promoter from cauliflower mosaic

                     virus"

     CDS             join(11844..9,200..2017)

                     /codon_start=1

                     /product="beta-glucuronidase"

                     /note="GUS"

                     /note="This version of the gusA gene has a 5' extension 

                     with a catalase intron to ensure expression in plants but 

                     not bacteria."

                     /translation="MVDLRNRRLVRPVETPTREIKKLDGLWAFSLDRENCGIDQRWWES

                     ALQESRAIAVPGSFNDQFADADIRNYAGNVWYQREVFIPKGWAGQRIVLRFDAVTHYGK

                     VWVNNQEVMEHQGGYTPFEADVTPYVIAGKSVRITVCVNNELNWQTIPPGMVITDENGK

                     KKQSYFHDFFNYAGIHRSVMLYTTPNTWVDDITVVTHVAQDCNHASVDWQVVANGDVSV

                     ELRDADQQVVATGQGTSGTLQVVNPHLWQPGEGYLYELEVTAKSQTESDIYPLRVGIRS

                     VAVKGQQFLINHKPFYFTGFGRHEDADLRGKGFDNVLMVHDHALMDWIGANSYRTSHYP

                     YAEEMLDWADEHGIVVIDETAAVGFQLSLGIGFEAGNKPKELYSEEAVNGETQQAHLQA

                     IKELIARDKNHPSVVMWSIANEPDTRPQGAREYFAPLAEATRKLDPTRPITCVNVMFCD

                     AHTDTISDLFDVLCLNRYYGWYVQSGDLETAEKVLEKELLAWQEKLHQPIIITEYGVDT

                     LAGLHSMYTDMWSEEYQCAWLDMYHRVFDRVSAVVGEQVWNFADFATSQGILRVGGNKK

                     GIFTRDRKPKSAAFLLQKRWTGMNFGEKPQQGGKQ"

ORIGIN

        1 gatctgaggg taaatttcta gtttttctcc ttcattttct tggttaggac ccttttctct

       61 ttttattttt ttgagctttg atctttcttt aaactgatct attttttaat tgattggtta

      121 tggtgtaaat attacatagc tttaactgat aatctgatta ctttatttcg tgtgtctatg

      181 atgatgatga tagttacaga accgacgact cgtccgtcct gtagaaaccc caacccgtga

      241 aatcaaaaaa ctcgacggcc tgtgggcatt cagtctggat cgcgaaaact gtggaattga

      301 tcagcgttgg tgggaaagcg cgttacaaga aagccgggca attgctgtgc caggcagttt

      361 taacgatcag ttcgccgatg cagatattcg taattatgcg ggcaacgtct ggtatcagcg

      421 cgaagtcttt ataccgaaag gttgggcagg ccagcgtatc gtgctgcgtt tcgatgcggt

      481 cactcattac ggcaaagtgt gggtcaataa tcaggaagtg atggagcatc agggcggcta

      541 tacgccattt gaagccgatg tcacgccgta tgttattgcc gggaaaagtg tacgtatcac

      601 cgtttgtgtg aacaacgaac tgaactggca gactatcccg ccgggaatgg tgattaccga

      661 cgaaaacggc aagaaaaagc agtcttactt ccatgatttc tttaactatg ccggaatcca

      721 tcgcagcgta atgctctaca ccacgccgaa cacctgggtg gacgatatca ccgtggtgac

      781 gcatgtcgcg caagactgta accacgcgtc tgttgactgg caggtggtgg ccaatggtga

      841 tgtcagcgtt gaactgcgtg atgcggatca acaggtggtt gcaactggac aaggcactag

      901 cgggactttg caagtggtga atccgcacct ctggcaaccg ggtgaaggtt atctctatga

      961 actcgaagtc acagccaaaa gccagacaga gtctgatatc tacccgcttc gcgtcggcat

     1021 ccggtcagtg gcagtgaagg gccaacagtt cctgattaac cacaaaccgt tctactttac

     1081 tggctttggt cgtcatgaag atgcggactt acgtggcaaa ggattcgata acgtgctgat

     1141 ggtgcacgac cacgcattaa tggactggat tggggccaac tcctaccgta cctcgcatta

     1201 cccttacgct gaagagatgc tcgactgggc agatgaacat ggcatcgtgg tgattgatga

     1261 aactgctgct gtcggctttc agctgtcttt aggcattggt ttcgaagcgg gcaacaagcc

     1321 gaaagaactg tacagcgaag aggcagtcaa cggggaaact cagcaagcgc acttacaggc

     1381 gattaaagag ctgatagcgc gtgacaaaaa ccacccaagc gtggtgatgt ggagtattgc

     1441 caacgaaccg gatacccgtc cgcaaggtgc acgggaatat ttcgcgccac tggcggaagc

     1501 aacgcgtaaa ctcgacccga cgcgtccgat cacctgcgtc aatgtaatgt tctgcgacgc

     1561 tcacaccgat accatcagcg atctctttga tgtgctgtgc ctgaaccgtt attacggatg

     1621 gtatgtccaa agcggcgatt tggaaacggc agagaaggta ctggaaaaag aacttctggc

     1681 ctggcaggag aaactgcatc agccgattat catcaccgaa tacggcgtgg atacgttagc

     1741 cgggctgcac tcaatgtaca ccgacatgtg gagtgaagag tatcagtgtg catggctgga

     1801 tatgtatcac cgcgtctttg atcgcgtcag cgccgtcgtc ggtgaacagg tatggaattt

     1861 cgccgatttt gcgacctcgc aaggcatatt gcgcgttggc ggtaacaaga aagggatctt

     1921 cactcgcgac cgcaaaccga agtcggcggc ttttctgctg caaaaacgct ggactggcat

     1981 gaacttcggt gaaaaaccgc agcagggagg caaacaagct agccaccacc accaccacca

     2041 cgtgtgaatt acaggtgacc agctcgaatt tccccgatcg ttcaaacatt tggcaataaa

     2101 gtttcttaag attgaatcct gttgccggtc ttgcgatgat tatcatataa tttctgttga

     2161 attacgttaa gcatgtaata attaacatgt aatgcatgac gttatttatg agatgggttt

     2221 ttatgattag agtcccgcaa ttatacattt aatacgcgat agaaaacaaa atatagcgcg

     2281 caaactagga taaattatcg cgcgcggtgt catctatgtt actagatcgg gaattaaact

     2341 atcagtgttt gacaggatat attggcgggt aaacctaaga gaaaagagcg tttattagaa

     2401 taacggatat ttaaaagggc gtgaaaaggt ttatccgttc gtccatttgt atgtgcatgc

     2461 caaccacagg gttcccctcg ggatcaaagt actttgatcc aacccctccg ctgctatagt

     2521 gcagtcggct tctgacgttc agtgcagccg tcttctgaaa acgacatgtc gcacaagtcc

     2581 taagttacgc gacaggctgc cgccctgccc ttttcctggc gttttcttgt cgcgtgtttt

     2641 agtcgcataa agtagaatac ttgcgactag aaccggagac attacgccat gaacaagagc

     2701 gccgccgctg gcctgctggg ctatgcccgc gtcagcaccg acgaccagga cttgaccaac

     2761 caacgggccg aactgcacgc ggccggctgc accaagctgt tttccgagaa gatcaccggc

     2821 accaggcgcg accgcccgga gctggccagg atgcttgacc acctacgccc tggcgacgtt

     2881 gtgacagtga ccaggctaga ccgcctggcc cgcagcaccc gcgacctact ggacattgcc

     2941 gagcgcatcc aggaggccgg cgcgggcctg cgtagcctgg cagagccgtg ggccgacacc

     3001 accacgccgg ccggccgcat ggtgttgacc gtgttcgccg gcattgccga gttcgagcgt

     3061 tccctaatca tcgaccgcac ccggagcggg cgcgaggccg ccaaggcccg aggcgtgaag

     3121 tttggccccc gccctaccct caccccggca cagatcgcgc acgcccgcga gctgatcgac

     3181 caggaaggcc gcaccgtgaa agaggcggct gcactgcttg gcgtgcatcg ctcgaccctg

     3241 taccgcgcac ttgagcgcag cgaggaagtg acgcccaccg aggccaggcg gcgcggtgcc

     3301 ttccgtgagg acgcattgac cgaggccgac gccctggcgg ccgccgagaa tgaacgccaa

     3361 gaggaacaag catgaaaccg caccaggacg gccaggacga accgtttttc attaccgaag

     3421 agatcgaggc ggagatgatc gcggccgggt acgtgttcga gccgcccgcg cacgtctcaa

     3481 ccgtgcggct gcatgaaatc ctggccggtt tgtctgatgc caagctggcg gcctggccgg

     3541 ccagcttggc cgctgaagaa accgagcgcc gccgtctaaa aaggtgatgt gtatttgagt

     3601 aaaacagctt gcgtcatgcg gtcgctgcgt atatgatgcg atgagtaaat aaacaaatac

     3661 gcaaggggaa cgcatgaagg ttatcgctgt acttaaccag aaaggcgggt caggcaagac

     3721 gaccatcgca acccatctag cccgcgccct gcaactcgcc ggggccgatg ttctgttagt

     3781 cgattccgat ccccagggca gtgcccgcga ttgggcggcc gtgcgggaag atcaaccgct

     3841 aaccgttgtc ggcatcgacc gcccgacgat tgaccgcgac gtgaaggcca tcggccggcg

     3901 cgacttcgta gtgatcgacg gagcgcccca ggcggcggac ttggctgtgt ccgcgatcaa

     3961 ggcagccgac ttcgtgctga ttccggtgca gccaagccct tacgacatat gggccaccgc

     4021 cgacctggtg gagctggtta agcagcgcat tgaggtcacg gatggaaggc tacaagcggc

     4081 ctttgtcgtg tcgcgggcga tcaaaggcac gcgcatcggc ggtgaggttg ccgaggcgct

     4141 ggccgggtac gagctgccca ttcttgagtc ccgtatcacg cagcgcgtga gctacccagg

     4201 cactgccgcc gccggcacaa ccgttcttga atcagaaccc gagggcgacg ctgcccgcga

     4261 ggtccaggcg ctggccgctg aaattaaatc aaaactcatt tgagttaatg aggtaaagag

     4321 aaaatgagca aaagcacaaa cacgctaagt gccggccgtc cgagcgcacg cagcagcaag

     4381 gctgcaacgt tggccagcct ggcagacacg ccagccatga agcgggtcaa ctttcagttg

     4441 ccggcggagg atcacaccaa gctgaagatg tacgcggtac gccaaggcaa gaccattacc

     4501 gagctgctat ctgaatacat cgcgcagcta ccagagtaaa tgagcaaatg aataaatgag

     4561 tagatgaatt ttagcggcta aaggaggcgg catggaaaat caagaacaac caggcaccga

     4621 cgccgtggaa tgccccatgt gtggaggaac gggcggttgg ccaggcgtaa gcggctgggt

     4681 tgtctgccgg ccctgcaatg gcactggaac ccccaagccc gaggaatcgg cgtgacggtc

     4741 gcaaaccatc cggcccggta caaatcggcg cggcgctggg tgatgacctg gtggagaagt

     4801 tgaaggccgc gcaggccgcc cagcggcaac gcatcgaggc agaagcacgc cccggtgaat

     4861 cgtggcaagc ggccgctgat cgaatccgca aagaatcccg gcaaccgccg gcagccggtg

     4921 cgccgtcgat taggaagccg cccaagggcg acgagcaacc agattttttc gttccgatgc

     4981 tctatgacgt gggcacccgc gatagtcgca gcatcatgga cgtggccgtt ttccgtctgt

     5041 cgaagcgtga ccgacgagct ggcgaggtga tccgctacga gcttccagac gggcacgtag

     5101 aggtttccgc agggccggcc ggcatggcca gtgtgtggga ttacgacctg gtactgatgg

     5161 cggtttccca tctaaccgaa tccatgaacc gataccggga agggaaggga gacaagcccg

     5221 gccgcgtgtt ccgtccacac gttgcggacg tactcaagtt ctgccggcga gccgatggcg

     5281 gaaagcagaa agacgacctg gtagaaacct gcattcggtt aaacaccacg cacgttgcca

     5341 tgcagcgtac gaagaaggcc aagaacggcc gcctggtgac ggtatccgag ggtgaagcct

     5401 tgattagccg ctacaagatc gtaaagagcg aaaccgggcg gccggagtac atcgagatcg

     5461 agctagctga ttggatgtac cgcgagatca cagaaggcaa gaacccggac gtgctgacgg

     5521 ttcaccccga ttactttttg atcgatcccg gcatcggccg ttttctctac cgcctggcac

     5581 gccgcgccgc aggcaaggca gaagccagat ggttgttcaa gacgatctac gaacgcagtg

     5641 gcagcgccgg agagttcaag aagttctgtt tcaccgtgcg caagctgatc gggtcaaatg

     5701 acctgccgga gtacgatttg aaggaggagg cggggcaggc tggcccgatc ctagtcatgc

     5761 gctaccgcaa cctgatcgag ggcgaagcat ccgccggttc ctaatgtacg gagcagatgc

     5821 tagggcaaat tgccctagca ggggaaaaag gtcgaaaagg tctctttcct gtggatagca

     5881 cgtacattgg gaacccaaag ccgtacattg ggaaccggaa cccgtacatt gggaacccaa

     5941 agccgtacat tgggaaccgg tcacacatgt aagtgactga tataaaagag aaaaaaggcg

     6001 atttttccgc ctaaaactct ttaaaactta ttaaaactct taaaacccgc ctggcctgtg

     6061 cataactgtc tggccagcgc acagccgaag agctgcaaaa agcgcctacc cttcggtcgc

     6121 tgcgctccct acgccccgcc gcttcgcgtc ggcctatcgc ggccgctggc cgctcaaaaa

     6181 tggctggcct acggccaggc aatctaccag ggcgcggaca agccgcgccg tcgccactcg

     6241 accgccggcg cccacatcaa ggcaccctgc ctcgcgcgtt tcggtgatga cggtgaaaac

     6301 ctctgacaca tgcagctccc ggagacggtc acagcttgtc tgtaagcgga tgccgggagc

     6361 agacaagccc gtcagggcgc gtcagcgggt gttggcgggt gtcggggcgc agccatgacc

     6421 cagtcacgta gcgatagcgg agtgtatact ggcttaacta tgcggcatca gagcagattg

     6481 tactgagagt gcaccatatg cggtgtgaaa taccgcacag atgcgtaagg agaaaatacc

     6541 gcatcaggcg ctcttccgct tcctcgctca ctgactcgct gcgctcggtc gttcggctgc

     6601 ggcgagcggt atcagctcac tcaaaggcgg taatacggtt atccacagaa tcaggggata

     6661 acgcaggaaa gaacatgtga gcaaaaggcc agcaaaaggc caggaaccgt aaaaaggccg

     6721 cgttgctggc gtttttccat aggctccgcc cccctgacga gcatcacaaa aatcgacgct

     6781 caagtcagag gtggcgaaac ccgacaggac tataaagata ccaggcgttt ccccctggaa

     6841 gctccctcgt gcgctctcct gttccgaccc tgccgcttac cggatacctg tccgcctttc

     6901 tcccttcggg aagcgtggcg ctttctcata gctcacgctg taggtatctc agttcggtgt

     6961 aggtcgttcg ctccaagctg ggctgtgtgc acgaaccccc cgttcagccc gaccgctgcg

     7021 ccttatccgg taactatcgt cttgagtcca acccggtaag acacgactta tcgccactgg

     7081 cagcagccac tggtaacagg attagcagag cgaggtatgt aggcggtgct acagagttct

     7141 tgaagtggtg gcctaactac ggctacacta gaaggacagt atttggtatc tgcgctctgc

     7201 tgaagccagt taccttcgga aaaagagttg gtagctcttg atccggcaaa caaaccaccg

     7261 ctggtagcgg tggttttttt gtttgcaagc agcagattac gcgcagaaaa aaaggatctc

     7321 aagaagatcc tttgatcttt tctacggggt ctgacgctca gtggaacgaa aactcacgtt

     7381 aagggatttt ggtcatgcat tctaggtact aaaacaattc atccagtaaa atataatatt

     7441 ttattttctc ccaatcaggc ttgatcccca gtaagtcaaa aaatagctcg acatactgtt

     7501 cttccccgat atcctccctg atcgaccgga cgcagaaggc aatgtcatac cacttgtccg

     7561 ccctgccgct tctcccaaga tcaataaagc cacttacttt gccatctttc acaaagatgt

     7621 tgctgtctcc caggtcgccg tgggaaaaga caagttcctc ttcgggcttt tccgtcttta

     7681 aaaaatcata cagctcgcgc ggatctttaa atggagtgtc ttcttcccag ttttcgcaat

     7741 ccacatcggc cagatcgtta ttcagtaagt aatccaattc ggctaagcgg ctgtctaagc

     7801 tattcgtata gggacaatcc gatatgtcga tggagtgaaa gagcctgatg cactccgcat

     7861 acagctcgat aatcttttca gggctttgtt catcttcata ctcttccgag caaaggacgc

     7921 catcggcctc actcatgagc agattgctcc agccatcatg ccgttcaaag tgcaggacct

     7981 ttggaacagg cagctttcct tccagccata gcatcatgtc cttttcccgt tccacatcat

     8041 aggtggtccc tttataccgg ctgtccgtca tttttaaata taggttttca ttttctccca

     8101 ccagcttata taccttagca ggagacattc cttccgtatc ttttacgcag cggtattttt

     8161 cgatcagttt tttcaattcc ggtgatattc tcattttagc catttattat ttccttcctc

     8221 ttttctacag tatttaaaga taccccaaga agctaattat aacaagacga actccaattc

     8281 actgttcctt gcattctaaa accttaaata ccagaaaaca gctttttcaa agttgttttc

     8341 aaagttggcg tataacatag tatcgacgga gccgattttg aaaccgcggt gatcacaggc

     8401 agcaacgctc tgtcatcgtt acaatcaaca tgctaccctc cgcgagatca tccgtgtttc

     8461 aaacccggca gcttagttgc cgttcttccg aatagcatcg gtaacatgag caaagtctgc

     8521 cgccttacaa cggctctccc gctgacgccg tcccggactg atgggctgcc tgtatcgagt

     8581 ggtgattttg tgccgagctg ccggtcgggg agctgttggc tggctggtgg caggatatat

     8641 tgtggtgtaa acaaattgac gcttagacaa cttaataaca cattgcggac gtttttaatg

     8701 tactgaatta acgccgaatt aattcggggg atctggattt tagtactgga ttttggtttt

     8761 aggaattaga aattttattg atagaagtat tttacaaata caaatacata ctaagggttt

     8821 cttatatgct caacacatga gcgaaaccct ataggaaccc taattccctt atctgggaac

     8881 tactcacaca ttattatgga gaaactcgag cttgtcgatc gacagatccg gtcggcatct

     8941 actctatttc tttgccctcg gacgagtgct ggggcgtcgg tttccactat cggcgagtac

     9001 ttctacacag ccatcggtcc agacggccgc gcttctgcgg gcgatttgtg tacgcccgac

     9061 agtcccggct ccggatcgga cgattgcgtc gcatcgaccc tgcgcccaag ctgcatcatc

     9121 gaaattgccg tcaaccaagc tctgatagag ttggtcaaga ccaatgcgga gcatatacgc

     9181 ccggagtcgt ggcgatcctg caagctccgg atgcctccgc tcgaagtagc gcgtctgctg

     9241 ctccatacaa gccaaccacg gcctccagaa gaagatgttg gcgacctcgt attgggaatc

     9301 cccgaacatc gcctcgctcc agtcaatgac cgctgttatg cggccattgt ccgtcaggac

     9361 attgttggag ccgaaatccg cgtgcacgag gtgccggact tcggggcagt cctcggccca

     9421 aagcatcagc tcatcgagag cctgcgcgac ggacgcactg acggtgtcgt ccatcacagt

     9481 ttgccagtga tacacatggg gatcagcaat cgcgcatatg aaatcacgcc atgtagtgta

     9541 ttgaccgatt ccttgcggtc cgaatgggcc gaacccgctc gtctggctaa gatcggccgc

     9601 agcgatcgca tccatagcct ccgcgaccgg ttgtagaaca gcgggcagtt cggtttcagg

     9661 caggtcttgc aacgtgacac cctgtgcacg gcgggagatg caataggtca ggctctcgct

     9721 aaactcccca atgtcaagca cttccggaat cgggagcgcg gccgatgcaa agtgccgata

     9781 aacataacga tctttgtaga aaccatcggc gcagctattt acccgcagga catatccacg

     9841 ccctcctaca tcgaagctga aagcacgaga ttcttcgccc tccgagagct gcatcaggtc

     9901 ggagacgctg tcgaactttt cgatcagaaa cttctcgaca gacgtcgcgg tgagttcagg

     9961 ctttttcata tctcattgcc ccccgggatc tgcgaaagct cgagagagat agatttgtag

    10021 agagagactg gtgatttcag cgtgtcctct ccaaatgaaa tgaacttcct tatatagagg

    10081 aaggtcttgc gaaggatagt gggattgtgc gtcatccctt acgtcagtgg agatatcaca

    10141 tcaatccact tgctttgaag acgtggttgg aacgtcttct ttttccacga tgctcctcgt

    10201 gggtgggggt ccatctttgg gaccactgtc ggcagaggca tcttgaacga tagcctttcc

    10261 tttatcgcaa tgatggcatt tgtaggtgcc accttccttt tctactgtcc ttttgatgaa

    10321 gtgacagata gctgggcaat ggaatccgag gaggtttccc gatattaccc tttgttgaaa

    10381 agtctcaata gccctttggt cttctgagac tgtatctttg atattcttgg agtagacgag

    10441 agtgtcgtgc tccaccatgt tatcacatca atccacttgc tttgaagacg tggttggaac

    10501 gtcttctttt tccacgatgc tcctcgtggg tgggggtcca tctttgggac cactgtcggc

    10561 agaggcatct tgaacgatag cctttccttt atcgcaatga tggcatttgt aggtgccacc

    10621 ttccttttct actgtccttt tgatgaagtg acagatagct gggcaatgga atccgaggag

    10681 gtttcccgat attacccttt gttgaaaagt ctcaatagcc ctttggtctt ctgagactgt

    10741 atctttgata ttcttggagt agacgagagt gtcgtgctcc accatgttgg caagctgctc

    10801 tagccaatac gcaaaccgcc tctccccgcg cgttggccga ttcattaatg cagctggcac

    10861 gacaggtttc ccgactggaa agcgggcagt gagcgcaacg caattaatgt gagttagctc

    10921 actcattagg caccccaggc tttacacttt atgcttccgg ctcgtatgtt gtgtggaatt

    10981 gtgagcggat aacaatttca cacaggaaac agctatgacc atgattacga attcgagctc

    11041 ggtacccggg gatcctctag agtcgacctg caggcatgca agcttggcac tggccgtcgt

    11101 tttacaacgt cgtgactggg aaaaccctgg cgttacccaa cttaatcgcc ttgcagcaca

    11161 tccccctttc gccagctggc gtaatagcga agaggcccgc accgatcgcc cttcccaaca

    11221 gttgcgcagc ctgaatggcg aatgctagag cagcttgagc ttggatcaga ttgtcgtttc

    11281 ccgccttcag tttagcttca tggagtcaaa gattcaaata gaggacctaa cagaactcgc

    11341 cgtaaagact ggcgaacagt tcatacagag tctcttacga ctcaatgaca agaagaaaat

    11401 cttcgtcaac atggtggagc acgacacact tgtctactcc aaaaatatca aagatacagt

    11461 ctcagaagac caaagggcaa ttgagacttt tcaacaaagg gtaatatccg gaaacctcct

    11521 cggattccat tgcccagcta tctgtcactt tattgtgaag atagtggaaa aggaaggtgg

    11581 ctcctacaaa tgccatcatt gcgataaagg aaaggccatc gttgaagatg cctctgccga

    11641 cagtggtccc aaagatggac ccccacccac gaggagcatc gtggaaaaag aagacgttcc

    11701 aaccacgtct tcaaagcaag tggattgatg tgatatctcc actgacgtaa gggatgacgc

    11761 acaatcccac tatccttcgc aagacccttc ctctatataa ggaagttcat ttcatttgga

    11821 gagaacacgg gggactcttg accatggta

//

 

Caution:
Product is for research use only!

 

 

Search name

pCAMBIA1301,Plasmid pCAMBIA1301,pCAMBIA1301 vector

No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart