PCAMBIA1302

$260.00

  • Model: PVT11141
  • 50 Units in Stock
Ask a question


Add to Cart:

PCAMBIA1302


Catalog No. PVT11141
Packing 2ug

 

PCAMBIA1302 Information
Function plant expression plasmid
Resistance Kan
Screen HygR
Strain DH5alpha
Culture temperature 37degrees centigrade
Replicon pVS1V
Copy
Promoter Lac,35s
 

PCAMBIA1302 Description

1.High copy number in E.coli for high DNA yields2.
pVS1 replicon for high stability in Agrobacterium
3.Small size
4.Restriction sites designed for modular plasmid modifications and small but adequatepoly-linkers for introducing your DNA of interest
5. Bacterial selection with kanamycin
6.Plant selection with hygromycin B
7.Simple means to construct translational fusions to gusA reporter genes
 

PCAMBIA1302 Cloning site

PCAMBIA1302-vector

 

PCAMBIA1302 Sequence

LOCUS       Exported               10549 bp ds-DNA     circular SYN 13-DEC-2017

DEFINITION  synthetic circular DNA

FEATURES             Location/Qualifiers

     source          1..10549

                     /organism="synthetic DNA construct"

                     /mol_type="other DNA"

     CDS             17..727

                     /codon_start=1

                     /gene="mgfp5"

                     /product="GFP with folding enhancement mutations"

                     /label=mgfp5

                     /note="suitable for expression in plants due to removal of 

                     a cryptic intron"

                     /translation="SKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKF

                     ICTTGKLPVPWPTLVTTFSYGVQCFSRYPDHMKRHDFFKSAMPEGYVQERTIFFKDDGN

                     YKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKAN

                     FKTRHNIEDGGVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEF

                     VTAAGITHGMDELYK"

     CDS             734..751

                     /codon_start=1

                     /product="6xHis affinity tag"

                     /label=6xHis

                     /translation="HHHHHH"

     terminator      783..1035

                     /label=NOS terminator

                     /note="nopaline synthase terminator and poly(A) signal"

     misc_feature    1057..1081

                     /label=RB T-DNA repeat

                     /note="right border repeat from nopaline C58 T-DNA"

     CDS             2381..3010

                     /codon_start=1

                     /product="stability protein from the Pseudomonas plasmid 

                     pVS1 (Heeb et al., 2000)"

                     /label=pVS1 StaA

                     /translation="MKVIAVLNQKGGSGKTTIATHLARALQLAGADVLLVDSDPQGSAR

                     DWAAVREDQPLTVVGIDRPTIDRDVKAIGRRDFVVIDGAPQAADLAVSAIKAADFVLIP

                     VQPSPYDIWATADLVELVKQRIEVTDGRLQAAFVVSRAIKGTRIGGEVAEALAGYELPI

                     LESRITQRVSYPGTAAAGTTVLESEPEGDAAREVQALAAEIKSKLI"

     CDS             3444..4511

                     /codon_start=1

                     /product="replication protein from the Pseudomonas plasmid 

                     pVS1 (Heeb et al., 2000)"

                     /label=pVS1 RepA

                     /translation="GRKPSGPVQIGAALGDDLVEKLKAAQAAQRQRIEAEARPGESWQA

                     AADRIRKESRQPPAAGAPSIRKPPKGDEQPDFFVPMLYDVGTRDSRSIMDVAVFRLSKR

                     DRRAGEVIRYELPDGHVEVSAGPAGMASVWDYDLVLMAVSHLTESMNRYREGKGDKPGR

                     VFRPHVADVLKFCRRADGGKQKDDLVETCIRLNTTHVAMQRTKKAKNGRLVTVSEGEAL

                     ISRYKIVKSETGRPEYIEIELADWMYREITEGKNPDVLTVHPDYFLIDPGIGRFLYRLA

                     RRAAGKAEARWLFKTIYERSGSAGEFKKFCFTVRKLIGSNDLPEYDLKEEAGQAGPILV

                     MRYRNLIEGEASAGS"

     rep_origin      4577..4771

                     /label=pVS1 oriV

                     /note="origin of replication for the Pseudomonas plasmid 

                     pVS1 (Heeb et al., 2000)"

     misc_feature    5115..5255

                     /label=bom

                     /note="basis of mobility region from pBR322"

     rep_origin      complement(5441..6029)

                     /direction=LEFT

                     /label=ori

                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 

                     replication"

     CDS             complement(6116..6910)

                     /codon_start=1

                     /gene="aphA-3"

                     /product="aminoglycoside phosphotransferase"

                     /label=Kan

                     /note="confers resistance to kanamycin"

                     /translation="MAKMRISPELKKLIEKYRCVKDTEGMSPAKVYKLVGENENLYLKM

                     TDSRYKGTTYDVEREKDMMLWLEGKLPVPKVLHFERHDGWSNLLMSEADGVLCSEEYED

                     EQSPEKIIELYAECIRLFHSIDISDCPYTNSLDSRLAELDYLLNNDLADVDCENWEEDT

                     PFKDPRELYDFLKTEKPEEELVFSHGDLGDSNIFVKDGKVSGFIDLGRSGRADKWYDIA

                     FCVRSIREDIGEEQYVELFFDLLGIKPDWEKIKYYILLDELF"

     misc_feature    7335..7359

                     /label=LB T-DNA repeat

                     /note="left border repeat from nopaline C58 T-DNA"

     polyA_signal    7437..7611

                     /label=CaMV poly(A) signal

                     /note="cauliflower mosaic virus polyadenylation signal"

     CDS             complement(7651..8676)

                     /codon_start=1

                     /gene="aph(4)-Ia"

                     /product="aminoglycoside phosphotransferase from E. coli"

                     /label=Hyg

                     /note="confers resistance to hygromycin"

                     /translation="MKKPELTATSVEKFLIEKFDSVSDLMQLSEGEESRAFSFDVGGRG

                     YVLRVNSCADGFYKDRYVYRHFASAALPIPEVLDIGEFSESLTYCISRRAQGVTLQDLP

                     ETELPAVLQPVAEAMDAIAAADLSQTSGFGPFGPQGIGQYTTWRDFICAIADPHVYHWQ

                     TVMDDTVSASVAQALDELMLWAEDCPEVRHLVHADFGSNNVLTDNGRITAVIDWSEAMF

                     GDSQYEVANIFFWRPWLACMEQQTRYFERRHPELAGSPRLRAYMLRIGLDQLYQSLVDG

                     NFDDAAWAQGRCDAIVRSGAGTVGRTQIARRSAAVWTDGCVEVLADSGNRRPSTRPRAK

                     K"

     promoter        complement(8744..9421)

                     /label=CaMV 35S promoter (enhanced)

                     /note="cauliflower mosaic virus 35S promoter with a 

                     duplicated enhancer region"

     protein_bind    9612..9633

                     /label=CAP binding site

                     /bound_moiety="E. coli catabolite activator protein"

                     /note="CAP binding activates transcription in the presence 

                     of cAMP."

     promoter        9648..9678

                     /label=lac promoter

                     /note="promoter for the E. coli lac operon"

     protein_bind    9686..9702

                     /label=lac operator

                     /bound_moiety="lac repressor encoded by lacI"

                     /note="The lac repressor binds to the lac operator to 

                     inhibit transcription in E. coli. This inhibition can be 

                     relieved by adding lactose or 

                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."

     CDS             9722..9955

                     /codon_start=1

                     /gene="lacZ fragment"

                     /product="LacZ-alpha fragment of beta-galactosidase"

                     /label=lacZ-alpha

                     /translation="MTMITNSSSVPGDPLESTCRHASLALAVVLQRRDWENPGVTQLNR

                     LAAHPPFASWRNSEEARTDRPSQQLRSLNGEC"

     misc_feature    9736..9792

                     /label=MCS

                     /note="pUC18/19 multiple cloning site"

     promoter        10189..10534

                     /label=CaMV 35S promoter

                     /note="strong constitutive promoter from cauliflower mosaic

                     virus"

ORIGIN

        1 catggtagat ctgactagta aaggagaaga acttttcact ggagttgtcc caattcttgt

       61 tgaattagat ggtgatgtta atgggcacaa attttctgtc agtggagagg gtgaaggtga

      121 tgcaacatac ggaaaactta cccttaaatt tatttgcact actggaaaac tacctgttcc

      181 gtggccaaca cttgtcacta ctttctctta tggtgttcaa tgcttttcaa gatacccaga

      241 tcatatgaag cggcacgact tcttcaagag cgccatgcct gagggatacg tgcaggagag

      301 gaccatcttc ttcaaggacg acgggaacta caagacacgt gctgaagtca agtttgaggg

      361 agacaccctc gtcaacagga tcgagcttaa gggaatcgat ttcaaggagg acggaaacat

      421 cctcggccac aagttggaat acaactacaa ctcccacaac gtatacatca tggccgacaa

      481 gcaaaagaac ggcatcaaag ccaacttcaa gacccgccac aacatcgaag acggcggcgt

      541 gcaactcgct gatcattatc aacaaaatac tccaattggc gatggccctg tccttttacc

      601 agacaaccat tacctgtcca cacaatctgc cctttcgaaa gatcccaacg aaaagagaga

      661 ccacatggtc cttcttgagt ttgtaacagc tgctgggatt acacatggca tggatgaact

      721 atacaaagct agccaccacc accaccacca cgtgtgaatt ggtgaccagc tcgaatttcc

      781 ccgatcgttc aaacatttgg caataaagtt tcttaagatt gaatcctgtt gccggtcttg

      841 cgatgattat catataattt ctgttgaatt acgttaagca tgtaataatt aacatgtaat

      901 gcatgacgtt atttatgaga tgggttttta tgattagagt cccgcaatta tacatttaat

      961 acgcgataga aaacaaaata tagcgcgcaa actaggataa attatcgcgc gcggtgtcat

     1021 ctatgttact agatcgggaa ttaaactatc agtgtttgac aggatatatt ggcgggtaaa

     1081 cctaagagaa aagagcgttt attagaataa cggatattta aaagggcgtg aaaaggttta

     1141 tccgttcgtc catttgtatg tgcatgccaa ccacagggtt cccctcggga tcaaagtact

     1201 ttgatccaac ccctccgctg ctatagtgca gtcggcttct gacgttcagt gcagccgtct

     1261 tctgaaaacg acatgtcgca caagtcctaa gttacgcgac aggctgccgc cctgcccttt

     1321 tcctggcgtt ttcttgtcgc gtgttttagt cgcataaagt agaatacttg cgactagaac

     1381 cggagacatt acgccatgaa caagagcgcc gccgctggcc tgctgggcta tgcccgcgtc

     1441 agcaccgacg accaggactt gaccaaccaa cgggccgaac tgcacgcggc cggctgcacc

     1501 aagctgtttt ccgagaagat caccggcacc aggcgcgacc gcccggagct ggccaggatg

     1561 cttgaccacc tacgccctgg cgacgttgtg acagtgacca ggctagaccg cctggcccgc

     1621 agcacccgcg acctactgga cattgccgag cgcatccagg aggccggcgc gggcctgcgt

     1681 agcctggcag agccgtgggc cgacaccacc acgccggccg gccgcatggt gttgaccgtg

     1741 ttcgccggca ttgccgagtt cgagcgttcc ctaatcatcg accgcacccg gagcgggcgc

     1801 gaggccgcca aggcccgagg cgtgaagttt ggcccccgcc ctaccctcac cccggcacag

     1861 atcgcgcacg cccgcgagct gatcgaccag gaaggccgca ccgtgaaaga ggcggctgca

     1921 ctgcttggcg tgcatcgctc gaccctgtac cgcgcacttg agcgcagcga ggaagtgacg

     1981 cccaccgagg ccaggcggcg cggtgccttc cgtgaggacg cattgaccga ggccgacgcc

     2041 ctggcggccg ccgagaatga acgccaagag gaacaagcat gaaaccgcac caggacggcc

     2101 aggacgaacc gtttttcatt accgaagaga tcgaggcgga gatgatcgcg gccgggtacg

     2161 tgttcgagcc gcccgcgcac gtctcaaccg tgcggctgca tgaaatcctg gccggtttgt

     2221 ctgatgccaa gctggcggcc tggccggcca gcttggccgc tgaagaaacc gagcgccgcc

     2281 gtctaaaaag gtgatgtgta tttgagtaaa acagcttgcg tcatgcggtc gctgcgtata

     2341 tgatgcgatg agtaaataaa caaatacgca aggggaacgc atgaaggtta tcgctgtact

     2401 taaccagaaa ggcgggtcag gcaagacgac catcgcaacc catctagccc gcgccctgca

     2461 actcgccggg gccgatgttc tgttagtcga ttccgatccc cagggcagtg cccgcgattg

     2521 ggcggccgtg cgggaagatc aaccgctaac cgttgtcggc atcgaccgcc cgacgattga

     2581 ccgcgacgtg aaggccatcg gccggcgcga cttcgtagtg atcgacggag cgccccaggc

     2641 ggcggacttg gctgtgtccg cgatcaaggc agccgacttc gtgctgattc cggtgcagcc

     2701 aagcccttac gacatatggg ccaccgccga cctggtggag ctggttaagc agcgcattga

     2761 ggtcacggat ggaaggctac aagcggcctt tgtcgtgtcg cgggcgatca aaggcacgcg

     2821 catcggcggt gaggttgccg aggcgctggc cgggtacgag ctgcccattc ttgagtcccg

     2881 tatcacgcag cgcgtgagct acccaggcac tgccgccgcc ggcacaaccg ttcttgaatc

     2941 agaacccgag ggcgacgctg cccgcgaggt ccaggcgctg gccgctgaaa ttaaatcaaa

     3001 actcatttga gttaatgagg taaagagaaa atgagcaaaa gcacaaacac gctaagtgcc

     3061 ggccgtccga gcgcacgcag cagcaaggct gcaacgttgg ccagcctggc agacacgcca

     3121 gccatgaagc gggtcaactt tcagttgccg gcggaggatc acaccaagct gaagatgtac

     3181 gcggtacgcc aaggcaagac cattaccgag ctgctatctg aatacatcgc gcagctacca

     3241 gagtaaatga gcaaatgaat aaatgagtag atgaatttta gcggctaaag gaggcggcat

     3301 ggaaaatcaa gaacaaccag gcaccgacgc cgtggaatgc cccatgtgtg gaggaacggg

     3361 cggttggcca ggcgtaagcg gctgggttgt ctgccggccc tgcaatggca ctggaacccc

     3421 caagcccgag gaatcggcgt gacggtcgca aaccatccgg cccggtacaa atcggcgcgg

     3481 cgctgggtga tgacctggtg gagaagttga aggccgcgca ggccgcccag cggcaacgca

     3541 tcgaggcaga agcacgcccc ggtgaatcgt ggcaagcggc cgctgatcga atccgcaaag

     3601 aatcccggca accgccggca gccggtgcgc cgtcgattag gaagccgccc aagggcgacg

     3661 agcaaccaga ttttttcgtt ccgatgctct atgacgtggg cacccgcgat agtcgcagca

     3721 tcatggacgt ggccgttttc cgtctgtcga agcgtgaccg acgagctggc gaggtgatcc

     3781 gctacgagct tccagacggg cacgtagagg tttccgcagg gccggccggc atggccagtg

     3841 tgtgggatta cgacctggta ctgatggcgg tttcccatct aaccgaatcc atgaaccgat

     3901 accgggaagg gaagggagac aagcccggcc gcgtgttccg tccacacgtt gcggacgtac

     3961 tcaagttctg ccggcgagcc gatggcggaa agcagaaaga cgacctggta gaaacctgca

     4021 ttcggttaaa caccacgcac gttgccatgc agcgtacgaa gaaggccaag aacggccgcc

     4081 tggtgacggt atccgagggt gaagccttga ttagccgcta caagatcgta aagagcgaaa

     4141 ccgggcggcc ggagtacatc gagatcgagc tagctgattg gatgtaccgc gagatcacag

     4201 aaggcaagaa cccggacgtg ctgacggttc accccgatta ctttttgatc gatcccggca

     4261 tcggccgttt tctctaccgc ctggcacgcc gcgccgcagg caaggcagaa gccagatggt

     4321 tgttcaagac gatctacgaa cgcagtggca gcgccggaga gttcaagaag ttctgtttca

     4381 ccgtgcgcaa gctgatcggg tcaaatgacc tgccggagta cgatttgaag gaggaggcgg

     4441 ggcaggctgg cccgatccta gtcatgcgct accgcaacct gatcgagggc gaagcatccg

     4501 ccggttccta atgtacggag cagatgctag ggcaaattgc cctagcaggg gaaaaaggtc

     4561 gaaaaggtct ctttcctgtg gatagcacgt acattgggaa cccaaagccg tacattggga

     4621 accggaaccc gtacattggg aacccaaagc cgtacattgg gaaccggtca cacatgtaag

     4681 tgactgatat aaaagagaaa aaaggcgatt tttccgccta aaactcttta aaacttatta

     4741 aaactcttaa aacccgcctg gcctgtgcat aactgtctgg ccagcgcaca gccgaagagc

     4801 tgcaaaaagc gcctaccctt cggtcgctgc gctccctacg ccccgccgct tcgcgtcggc

     4861 ctatcgcggc cgctggccgc tcaaaaatgg ctggcctacg gccaggcaat ctaccagggc

     4921 gcggacaagc cgcgccgtcg ccactcgacc gccggcgccc acatcaaggc accctgcctc

     4981 gcgcgtttcg gtgatgacgg tgaaaacctc tgacacatgc agctcccgga gacggtcaca

     5041 gcttgtctgt aagcggatgc cgggagcaga caagcccgtc agggcgcgtc agcgggtgtt

     5101 ggcgggtgtc ggggcgcagc catgacccag tcacgtagcg atagcggagt gtatactggc

     5161 ttaactatgc ggcatcagag cagattgtac tgagagtgca ccatatgcgg tgtgaaatac

     5221 cgcacagatg cgtaaggaga aaataccgca tcaggcgctc ttccgcttcc tcgctcactg

     5281 actcgctgcg ctcggtcgtt cggctgcggc gagcggtatc agctcactca aaggcggtaa

     5341 tacggttatc cacagaatca ggggataacg caggaaagaa catgtgagca aaaggccagc

     5401 aaaaggccag gaaccgtaaa aaggccgcgt tgctggcgtt tttccatagg ctccgccccc

     5461 ctgacgagca tcacaaaaat cgacgctcaa gtcagaggtg gcgaaacccg acaggactat

     5521 aaagatacca ggcgtttccc cctggaagct ccctcgtgcg ctctcctgtt ccgaccctgc

     5581 cgcttaccgg atacctgtcc gcctttctcc cttcgggaag cgtggcgctt tctcatagct

     5641 cacgctgtag gtatctcagt tcggtgtagg tcgttcgctc caagctgggc tgtgtgcacg

     5701 aaccccccgt tcagcccgac cgctgcgcct tatccggtaa ctatcgtctt gagtccaacc

     5761 cggtaagaca cgacttatcg ccactggcag cagccactgg taacaggatt agcagagcga

     5821 ggtatgtagg cggtgctaca gagttcttga agtggtggcc taactacggc tacactagaa

     5881 ggacagtatt tggtatctgc gctctgctga agccagttac cttcggaaaa agagttggta

     5941 gctcttgatc cggcaaacaa accaccgctg gtagcggtgg tttttttgtt tgcaagcagc

     6001 agattacgcg cagaaaaaaa ggatctcaag aagatccttt gatcttttct acggggtctg

     6061 acgctcagtg gaacgaaaac tcacgttaag ggattttggt catgcattct aggtactaaa

     6121 acaattcatc cagtaaaata taatatttta ttttctccca atcaggcttg atccccagta

     6181 agtcaaaaaa tagctcgaca tactgttctt ccccgatatc ctccctgatc gaccggacgc

     6241 agaaggcaat gtcataccac ttgtccgccc tgccgcttct cccaagatca ataaagccac

     6301 ttactttgcc atctttcaca aagatgttgc tgtctcccag gtcgccgtgg gaaaagacaa

     6361 gttcctcttc gggcttttcc gtctttaaaa aatcatacag ctcgcgcgga tctttaaatg

     6421 gagtgtcttc ttcccagttt tcgcaatcca catcggccag atcgttattc agtaagtaat

     6481 ccaattcggc taagcggctg tctaagctat tcgtataggg acaatccgat atgtcgatgg

     6541 agtgaaagag cctgatgcac tccgcataca gctcgataat cttttcaggg ctttgttcat

     6601 cttcatactc ttccgagcaa aggacgccat cggcctcact catgagcaga ttgctccagc

     6661 catcatgccg ttcaaagtgc aggacctttg gaacaggcag ctttccttcc agccatagca

     6721 tcatgtcctt ttcccgttcc acatcatagg tggtcccttt ataccggctg tccgtcattt

     6781 ttaaatatag gttttcattt tctcccacca gcttatatac cttagcagga gacattcctt

     6841 ccgtatcttt tacgcagcgg tatttttcga tcagtttttt caattccggt gatattctca

     6901 ttttagccat ttattatttc cttcctcttt tctacagtat ttaaagatac cccaagaagc

     6961 taattataac aagacgaact ccaattcact gttccttgca ttctaaaacc ttaaatacca

     7021 gaaaacagct ttttcaaagt tgttttcaaa gttggcgtat aacatagtat cgacggagcc

     7081 gattttgaaa ccgcggtgat cacaggcagc aacgctctgt catcgttaca atcaacatgc

     7141 taccctccgc gagatcatcc gtgtttcaaa cccggcagct tagttgccgt tcttccgaat

     7201 agcatcggta acatgagcaa agtctgccgc cttacaacgg ctctcccgct gacgccgtcc

     7261 cggactgatg ggctgcctgt atcgagtggt gattttgtgc cgagctgccg gtcggggagc

     7321 tgttggctgg ctggtggcag gatatattgt ggtgtaaaca aattgacgct tagacaactt

     7381 aataacacat tgcggacgtt tttaatgtac tgaattaacg ccgaattaat tcgggggatc

     7441 tggattttag tactggattt tggttttagg aattagaaat tttattgata gaagtatttt

     7501 acaaatacaa atacatacta agggtttctt atatgctcaa cacatgagcg aaaccctata

     7561 ggaaccctaa ttcccttatc tgggaactac tcacacatta ttatggagaa actcgagctt

     7621 gtcgatcgac agatccggtc ggcatctact ctatttcttt gccctcggac gagtgctggg

     7681 gcgtcggttt ccactatcgg cgagtacttc tacacagcca tcggtccaga cggccgcgct

     7741 tctgcgggcg atttgtgtac gcccgacagt cccggctccg gatcggacga ttgcgtcgca

     7801 tcgaccctgc gcccaagctg catcatcgaa attgccgtca accaagctct gatagagttg

     7861 gtcaagacca atgcggagca tatacgcccg gagtcgtggc gatcctgcaa gctccggatg

     7921 cctccgctcg aagtagcgcg tctgctgctc catacaagcc aaccacggcc tccagaagaa

     7981 gatgttggcg acctcgtatt gggaatcccc gaacatcgcc tcgctccagt caatgaccgc

     8041 tgttatgcgg ccattgtccg tcaggacatt gttggagccg aaatccgcgt gcacgaggtg

     8101 ccggacttcg gggcagtcct cggcccaaag catcagctca tcgagagcct gcgcgacgga

     8161 cgcactgacg gtgtcgtcca tcacagtttg ccagtgatac acatggggat cagcaatcgc

     8221 gcatatgaaa tcacgccatg tagtgtattg accgattcct tgcggtccga atgggccgaa

     8281 cccgctcgtc tggctaagat cggccgcagc gatcgcatcc atagcctccg cgaccggttg

     8341 tagaacagcg ggcagttcgg tttcaggcag gtcttgcaac gtgacaccct gtgcacggcg

     8401 ggagatgcaa taggtcaggc tctcgctaaa ctccccaatg tcaagcactt ccggaatcgg

     8461 gagcgcggcc gatgcaaagt gccgataaac ataacgatct ttgtagaaac catcggcgca

     8521 gctatttacc cgcaggacat atccacgccc tcctacatcg aagctgaaag cacgagattc

     8581 ttcgccctcc gagagctgca tcaggtcgga gacgctgtcg aacttttcga tcagaaactt

     8641 ctcgacagac gtcgcggtga gttcaggctt tttcatatct cattgccccc cgggatctgc

     8701 gaaagctcga gagagataga tttgtagaga gagactggtg atttcagcgt gtcctctcca

     8761 aatgaaatga acttccttat atagaggaag gtcttgcgaa ggatagtggg attgtgcgtc

     8821 atcccttacg tcagtggaga tatcacatca atccacttgc tttgaagacg tggttggaac

     8881 gtcttctttt tccacgatgc tcctcgtggg tgggggtcca tctttgggac cactgtcggc

     8941 agaggcatct tgaacgatag cctttccttt atcgcaatga tggcatttgt aggtgccacc

     9001 ttccttttct actgtccttt tgatgaagtg acagatagct gggcaatgga atccgaggag

     9061 gtttcccgat attacccttt gttgaaaagt ctcaatagcc ctttggtctt ctgagactgt

     9121 atctttgata ttcttggagt agacgagagt gtcgtgctcc accatgttat cacatcaatc

     9181 cacttgcttt gaagacgtgg ttggaacgtc ttctttttcc acgatgctcc tcgtgggtgg

     9241 gggtccatct ttgggaccac tgtcggcaga ggcatcttga acgatagcct ttcctttatc

     9301 gcaatgatgg catttgtagg tgccaccttc cttttctact gtccttttga tgaagtgaca

     9361 gatagctggg caatggaatc cgaggaggtt tcccgatatt accctttgtt gaaaagtctc

     9421 aatagccctt tggtcttctg agactgtatc tttgatattc ttggagtaga cgagagtgtc

     9481 gtgctccacc atgttggcaa gctgctctag ccaatacgca aaccgcctct ccccgcgcgt

     9541 tggccgattc attaatgcag ctggcacgac aggtttcccg actggaaagc gggcagtgag

     9601 cgcaacgcaa ttaatgtgag ttagctcact cattaggcac cccaggcttt acactttatg

     9661 cttccggctc gtatgttgtg tggaattgtg agcggataac aatttcacac aggaaacagc

     9721 tatgaccatg attacgaatt cgagctcggt acccggggat cctctagagt cgacctgcag

     9781 gcatgcaagc ttggcactgg ccgtcgtttt acaacgtcgt gactgggaaa accctggcgt

     9841 tacccaactt aatcgccttg cagcacatcc ccctttcgcc agctggcgta atagcgaaga

     9901 ggcccgcacc gatcgccctt cccaacagtt gcgcagcctg aatggcgaat gctagagcag

     9961 cttgagcttg gatcagattg tcgtttcccg ccttcagttt agcttcatgg agtcaaagat

    10021 tcaaatagag gacctaacag aactcgccgt aaagactggc gaacagttca tacagagtct

    10081 cttacgactc aatgacaaga agaaaatctt cgtcaacatg gtggagcacg acacacttgt

    10141 ctactccaaa aatatcaaag atacagtctc agaagaccaa agggcaattg agacttttca

    10201 acaaagggta atatccggaa acctcctcgg attccattgc ccagctatct gtcactttat

    10261 tgtgaagata gtggaaaagg aaggtggctc ctacaaatgc catcattgcg ataaaggaaa

    10321 ggccatcgtt gaagatgcct ctgccgacag tggtcccaaa gatggacccc cacccacgag

    10381 gagcatcgtg gaaaaagaag acgttccaac cacgtcttca aagcaagtgg attgatgtga

    10441 tatctccact gacgtaaggg atgacgcaca atcccactat ccttcgcaag acccttcctc

    10501 tatataagga agttcatttc atttggagag aacacggggg actcttgac

//


Caution:
Product is for research use only!

No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart