pCAMBIA1303- TrpC- Hygro- gpdA- GFP

$260.00

  • Model: PVT11341
  • 50 Units in Stock
Ask a question


Add to Cart:

pCAMBIA1303-TrpC-Hygro-gpdA-GFP

Catalog No. PVT11341
Packing 2ug
 

pCAMBIA1303-TrpC-Hygro-gpdA-GFP Information

Promoter: gpdA promoter

Plasmid size: 12765bp

Prokaryotic resistance: kanamycin Kan

Screening markers: hygromycin Hyg

Cloned strain: Stbl3

Culture conditions: 37 centigrade, aerobic, LB

 

pCAMBIA1303-TrpC-Hygro-gpdA-GFP Description

PCAMBIA1303-TrpC-Hygro-gpdA-GFP is a fungal expression plasmid that can be mediated by Agrobacterium tumefaciens.
 

pCAMBIA1303-TrpC-Hygro-gpdA-GFP Sequence

LOCUS       Exported               12765 bp ds-DNA     circular SYN 22-SEP-2016

DEFINITION  synthetic circular DNA

SOURCE      synthetic DNA construct

  ORGANISM  synthetic DNA construct

REFERENCE   1  (bases 1 to 12765)

  AUTHORS   .

  TITLE     Direct Submission

FEATURES             Location/Qualifiers

     source          1..12765

                     /organism="synthetic DNA construct"

                     /mol_type="other DNA"

     CDS             14..1819

                     /codon_start=1

                     /gene="uidA (or gusA) from E. coli"

                     /product="beta-glucuronidase"

                     /label=GUS

                     /translation="LRPVETPTREIKKLDGLWAFSLDRENCGIDQRWWESALQESRAIA

                     VPGSFNDQFADADIRNYAGNVWYQREVFIPKGWAGQRIVLRFDAVTHYGKVWVNNQEVM

                     EHQGGYTPFEADVTPYVIAGKSVRITVCVNNELNWQTIPPGMVITDENGKKKQSYFHDF

                     FNYAGIHRSVMLYTTPNTWVDDITVVTHVAQDCNHASVDWQVVANGDVSVELRDADQQV

                     VATGQGTSGTLQVVNPHLWQPGEGYLYELCVTAKSQTECDIYPLRVGIRSVAVKGQQFL

                     INHKPFYFTGFGRHEDADLRGKGFDNVLMVHDHALMDWIGANSYRTSHYPYAEEMLDWA

                     DEHGIVVIDETAAVGFQLSLGIGFEAGNKPKELYSEEAVNGETQQAHLQAIKELIARDK

                     NHPSVVMWSIANEPDTRPQGAREYFAPLAEATRKLDPTRPITCVNVMFCDAHTDTISDL

                     FDVLCLNRYYGWYVQSGDLETAEKVLEKELLAWQEKLHQPIIITEYGVDTLAGLHSMYT

                     DMWSEEYQCAWLDMYHRVFDRVSAVVGEQVWNFADFATSQGILRVGGNKKGIFTRDRKP

                     KSAAFLLQKRWTGMNFGEKPQQGGKQ"

     CDS             1823..2533

                     /codon_start=1

                     /gene="mgfp5"

                     /product="GFP with folding enhancement mutations"

                     /label=mgfp5

                     /note="suitable for expression in plants due to removal of 

                     a cryptic intron"

                     /translation="SKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKF

                     ICTTGKLPVPWPTLVTTFSYGVQCFSRYPDHMKRHDFFKSAMPEGYVQERTIFFKDDGN

                     YKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKAN

                     FKTRHNIEDGGVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEF

                     VTAAGITHGMDELYK"

     CDS             2540..2557

                     /codon_start=1

                     /product="6xHis affinity tag"

                     /label=6xHis

                     /translation="HHHHHH"

     terminator      2589..2841

                     /label=NOS terminator

                     /note="nopaline synthase terminator and poly(A) signal"

     misc_feature    2863..2887

                     /label=RB T-DNA repeat

                     /note="right border repeat from nopaline C58 T-DNA"

     CDS             4187..4816

                     /codon_start=1

                     /product="stability protein from the Pseudomonas plasmid 

                     pVS1 (Heeb et al., 2000)"

                     /label=pVS1 StaA

                     /translation="MKVIAVLNQKGGSGKTTIATHLARALQLAGADVLLVDSDPQGSAR

                     DWAAVREDQPLTVVGIDRPTIDRDVKAIGRRDFVVIDGAPQAADLAVSAIKAADFVLIP

                     VQPSPYDIWATADLVELVKQRIEVTDGRLQAAFVVSRAIKGTRIGGEVAEALAGYELPI

                     LESRITQRVSYPGTAAAGTTVLESEPEGDAAREVQALAAEIKSKLI"

     CDS             5250..6317

                     /codon_start=1

                     /product="replication protein from the Pseudomonas plasmid 

                     pVS1 (Heeb et al., 2000)"

                     /label=pVS1 RepA

                     /translation="GRKPSGPVQIGAALGDDLVEKLKAAQAAQRQRIEAEARPGESWQA

                     AADRIRKESRQPPAAGAPSIRKPPKGDEQPDFFVPMLYDVGTRDSRSIMDVAVFRLSKR

                     DRRAGEVIRYELPDGHVEVSAGPAGMASVWDYDLVLMAVSHLTESMNRYREGKGDKPGR

                     VFRPHVADVLKFCRRADGGKQKDDLVETCIRLNTTHVAMQRTKKAKNGRLVTVSEGEAL

                     ISRYKIVKSETGRPEYIEIELADWMYREITEGKNPDVLTVHPDYFLIDPGIGRFLYRLA

                     RRAAGKAEARWLFKTIYERSGSAGEFKKFCFTVRKLIGSNDLPEYDLKEEAGQAGPILV

                     MRYRNLIEGEASAGS"

     rep_origin      6383..6577

                     /label=pVS1 oriV

                     /note="origin of replication for the Pseudomonas plasmid 

                     pVS1 (Heeb et al., 2000)"

     misc_feature    6921..7061

                     /label=bom

                     /note="basis of mobility region from pBR322"

     rep_origin      complement(7247..7835)

                     /direction=LEFT

                     /label=pUC ori

                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 

                     replication"

     CDS             complement(7922..8716)

                     /codon_start=1

                     /gene="aphA-3"

                     /product="aminoglycoside phosphotransferase"

                     /label=KanR

                     /note="confers resistance to kanamycin"

                     /translation="MAKMRISPELKKLIEKYRCVKDTEGMSPAKVYKLVGENENLYLKM

                     TDSRYKGTTYDVEREKDMMLWLEGKLPVPKVLHFERHDGWSNLLMSEADGVLCSEEYED

                     EQSPEKIIELYAECIRLFHSIDISDCPYTNSLDSRLAELDYLLNNDLADVDCENWEEDT

                     PFKDPRELYDFLKTEKPEEELVFSHGDLGDSNIFVKDGKVSGFIDLGRSGRADKWYDIA

                     FCVRSIREDIGEEQYVELFFDLLGIKPDWEKIKYYILLDELF"

     misc_feature    9141..9165

                     /label=LB T-DNA repeat

                     /note="left border repeat from nopaline C58 T-DNA"

     polyA_signal    9243..9417

                     /label=CaMV poly(A) signal

                     /note="cauliflower mosaic virus polyadenylation signal"

     misc_feature    9424..9654

                     /label=TrpC terminator

     CDS             complement(9740..10765)

                     /codon_start=1

                     /gene="aph(4)-Ia"

                     /product="aminoglycoside phosphotransferase from E. coli"

                     /label=HygR

                     /note="confers resistance to hygromycin"

                     /translation="MKKPELTATSVEKFLIEKFDSVSDLMQLSEGEESRAFSFDVGGRG

                     YVLRVNSCADGFYKDRYVYRHFASAALPIPEVLDIGEFSESLTYCISRRAQGVTLQDLP

                     ETELPAVLQPVAEAMDAIAAADLSQTSGFGPFGPQGIGQYTTWRDFICAIADPHVYHWQ

                     TVMDDTVSASVAQALDELMLWAEDCPEVRHLVHADFGSNNVLTDNGRITAVIDWSEAMF

                     GDSQYEVANIFFWRPWLACMEQQTRYFERRHPELAGSPRLRAYMLRIGLDQLYQSLVDG

                     NFDDAAWAQGRCDAIVRSGAGTVGRTQIARRSAAVWTDGCVEVLADSGNRRPSTRPRAK

                     K"

     misc_feature    complement(10766..11151)

                     /label=TrpC promoter

     promoter        complement(11242..11343)

                     /gene="S. cerevisiae TRP1"

                     /label=TRP1 promoter

     misc_feature    11356..12765

                     /label=gpdA

ORIGIN

        1 agatctgact agtttacgtc ctgtagaaac cccaacccgt gaaatcaaaa aactcgacgg

       61 cctgtgggca ttcagtctgg atcgcgaaaa ctgtggaatt gatcagcgtt ggtgggaaag

      121 cgcgttacaa gaaagccggg caattgctgt gccaggcagt tttaacgatc agttcgccga

      181 tgcagatatt cgtaattatg cgggcaacgt ctggtatcag cgcgaagtct ttataccgaa

      241 aggttgggca ggccagcgta tcgtgctgcg tttcgatgcg gtcactcatt acggcaaagt

      301 gtgggtcaat aatcaggaag tgatggagca tcagggcggc tatacgccat ttgaagccga

      361 tgtcacgccg tatgttattg ccgggaaaag tgtacgtatc accgtttgtg tgaacaacga

      421 actgaactgg cagactatcc cgccgggaat ggtgattacc gacgaaaacg gcaagaaaaa

      481 gcagtcttac ttccatgatt tctttaacta tgccggaatc catcgcagcg taatgctcta

      541 caccacgccg aacacctggg tggacgatat caccgtggtg acgcatgtcg cgcaagactg

      601 taaccacgcg tctgttgact ggcaggtggt ggccaatggt gatgtcagcg ttgaactgcg

      661 tgatgcggat caacaggtgg ttgcaactgg acaaggcact agcgggactt tgcaagtggt

      721 gaatccgcac ctctggcaac cgggtgaagg ttatctctat gaactgtgcg tcacagccaa

      781 aagccagaca gagtgtgata tctacccgct tcgcgtcggc atccggtcag tggcagtgaa

      841 gggccaacag ttcctgatta accacaaacc gttctacttt actggctttg gtcgtcatga

      901 agatgcggac ttacgtggca aaggattcga taacgtgctg atggtgcacg accacgcatt

      961 aatggactgg attggggcca actcctaccg tacctcgcat tacccttacg ctgaagagat

     1021 gctcgactgg gcagatgaac atggcatcgt ggtgattgat gaaactgctg ctgtcggctt

     1081 tcagctgtct ttaggcattg gtttcgaagc gggcaacaag ccgaaagaac tgtacagcga

     1141 agaggcagtc aacggggaaa ctcagcaagc gcacttacag gcgattaaag agctgatagc

     1201 gcgtgacaaa aaccacccaa gcgtggtgat gtggagtatt gccaacgaac cggatacccg

     1261 tccgcaaggt gcacgggaat atttcgcgcc actggcggaa gcaacgcgta aactcgaccc

     1321 gacgcgtccg atcacctgcg tcaatgtaat gttctgcgac gctcacaccg ataccatcag

     1381 cgatctcttt gatgtgctgt gcctgaaccg ttattacgga tggtatgtcc aaagcggcga

     1441 tttggaaacg gcagagaagg tactggaaaa agaacttctg gcctggcagg agaaactgca

     1501 tcagccgatt atcatcaccg aatacggcgt ggatacgtta gccgggctgc actcaatgta

     1561 caccgacatg tggagtgaag agtatcagtg tgcatggctg gatatgtatc accgcgtctt

     1621 tgatcgcgtc agcgccgtcg tcggtgaaca ggtatggaat ttcgccgatt ttgcgacctc

     1681 gcaaggcata ttgcgcgttg gcggtaacaa gaaagggatc ttcactcgcg accgcaaacc

     1741 gaagtcggcg gcttttctgc tgcaaaaacg ctggactggc atgaacttcg gtgaaaaacc

     1801 gcagcaggga ggcaaacaag ctagtaaagg agaagaactt ttcactggag ttgtcccaat

     1861 tcttgttgaa ttagatggtg atgttaatgg gcacaaattt tctgtcagtg gagagggtga

     1921 aggtgatgca acatacggaa aacttaccct taaatttatt tgcactactg gaaaactacc

     1981 tgttccgtgg ccaacacttg tcactacttt ctcttatggt gttcaatgct tttcaagata

     2041 cccagatcat atgaagcggc acgacttctt caagagcgcc atgcctgagg gatacgtgca

     2101 ggagaggacc atcttcttca aggacgacgg gaactacaag acacgtgctg aagtcaagtt

     2161 tgagggagac accctcgtca acaggatcga gcttaaggga atcgatttca aggaggacgg

     2221 aaacatcctc ggccacaagt tggaatacaa ctacaactcc cacaacgtat acatcatggc

     2281 cgacaagcaa aagaacggca tcaaagccaa cttcaagacc cgccacaaca tcgaagacgg

     2341 cggcgtgcaa ctcgctgatc attatcaaca aaatactcca attggcgatg gccctgtcct

     2401 tttaccagac aaccattacc tgtccacaca atctgccctt tcgaaagatc ccaacgaaaa

     2461 gagagaccac atggtccttc ttgagtttgt aacagctgct gggattacac atggcatgga

     2521 tgaactatac aaagctagcc accaccacca ccaccacgtg tgaattggtg accagctcga

     2581 atttccccga tcgttcaaac atttggcaat aaagtttctt aagattgaat cctgttgccg

     2641 gtcttgcgat gattatcata taatttctgt tgaattacgt taagcatgta ataattaaca

     2701 tgtaatgcat gacgttattt atgagatggg tttttatgat tagagtcccg caattataca

     2761 tttaatacgc gatagaaaac aaaatatagc gcgcaaacta ggataaatta tcgcgcgcgg

     2821 tgtcatctat gttactagat cgggaattaa actatcagtg tttgacagga tatattggcg

     2881 ggtaaaccta agagaaaaga gcgtttatta gaataacgga tatttaaaag ggcgtgaaaa

     2941 ggtttatccg ttcgtccatt tgtatgtgca tgccaaccac agggttcccc tcgggatcaa

     3001 agtactttga tccaacccct ccgctgctat agtgcagtcg gcttctgacg ttcagtgcag

     3061 ccgtcttctg aaaacgacat gtcgcacaag tcctaagtta cgcgacaggc tgccgccctg

     3121 cccttttcct ggcgttttct tgtcgcgtgt tttagtcgca taaagtagaa tacttgcgac

     3181 tagaaccgga gacattacgc catgaacaag agcgccgccg ctggcctgct gggctatgcc

     3241 cgcgtcagca ccgacgacca ggacttgacc aaccaacggg ccgaactgca cgcggccggc

     3301 tgcaccaagc tgttttccga gaagatcacc ggcaccaggc gcgaccgccc ggagctggcc

     3361 aggatgcttg accacctacg ccctggcgac gttgtgacag tgaccaggct agaccgcctg

     3421 gcccgcagca cccgcgacct actggacatt gccgagcgca tccaggaggc cggcgcgggc

     3481 ctgcgtagcc tggcagagcc gtgggccgac accaccacgc cggccggccg catggtgttg

     3541 accgtgttcg ccggcattgc cgagttcgag cgttccctaa tcatcgaccg cacccggagc

     3601 gggcgcgagg ccgccaaggc ccgaggcgtg aagtttggcc cccgccctac cctcaccccg

     3661 gcacagatcg cgcacgcccg cgagctgatc gaccaggaag gccgcaccgt gaaagaggcg

     3721 gctgcactgc ttggcgtgca tcgctcgacc ctgtaccgcg cacttgagcg cagcgaggaa

     3781 gtgacgccca ccgaggccag gcggcgcggt gccttccgtg aggacgcatt gaccgaggcc

     3841 gacgccctgg cggccgccga gaatgaacgc caagaggaac aagcatgaaa ccgcaccagg

     3901 acggccagga cgaaccgttt ttcattaccg aagagatcga ggcggagatg atcgcggccg

     3961 ggtacgtgtt cgagccgccc gcgcacgtct caaccgtgcg gctgcatgaa atcctggccg

     4021 gtttgtctga tgccaagctg gcggcctggc cggccagctt ggccgctgaa gaaaccgagc

     4081 gccgccgtct aaaaaggtga tgtgtatttg agtaaaacag cttgcgtcat gcggtcgctg

     4141 cgtatatgat gcgatgagta aataaacaaa tacgcaaggg gaacgcatga aggttatcgc

     4201 tgtacttaac cagaaaggcg ggtcaggcaa gacgaccatc gcaacccatc tagcccgcgc

     4261 cctgcaactc gccggggccg atgttctgtt agtcgattcc gatccccagg gcagtgcccg

     4321 cgattgggcg gccgtgcggg aagatcaacc gctaaccgtt gtcggcatcg accgcccgac

     4381 gattgaccgc gacgtgaagg ccatcggccg gcgcgacttc gtagtgatcg acggagcgcc

     4441 ccaggcggcg gacttggctg tgtccgcgat caaggcagcc gacttcgtgc tgattccggt

     4501 gcagccaagc ccttacgaca tatgggccac cgccgacctg gtggagctgg ttaagcagcg

     4561 cattgaggtc acggatggaa ggctacaagc ggcctttgtc gtgtcgcggg cgatcaaagg

     4621 cacgcgcatc ggcggtgagg ttgccgaggc gctggccggg tacgagctgc ccattcttga

     4681 gtcccgtatc acgcagcgcg tgagctaccc aggcactgcc gccgccggca caaccgttct

     4741 tgaatcagaa cccgagggcg acgctgcccg cgaggtccag gcgctggccg ctgaaattaa

     4801 atcaaaactc atttgagtta atgaggtaaa gagaaaatga gcaaaagcac aaacacgcta

     4861 agtgccggcc gtccgagcgc acgcagcagc aaggctgcaa cgttggccag cctggcagac

     4921 acgccagcca tgaagcgggt caactttcag ttgccggcgg aggatcacac caagctgaag

     4981 atgtacgcgg tacgccaagg caagaccatt accgagctgc tatctgaata catcgcgcag

     5041 ctaccagagt aaatgagcaa atgaataaat gagtagatga attttagcgg ctaaaggagg

     5101 cggcatggaa aatcaagaac aaccaggcac cgacgccgtg gaatgcccca tgtgtggagg

     5161 aacgggcggt tggccaggcg taagcggctg ggttgtctgc cggccctgca atggcactgg

     5221 aacccccaag cccgaggaat cggcgtgacg gtcgcaaacc atccggcccg gtacaaatcg

     5281 gcgcggcgct gggtgatgac ctggtggaga agttgaaggc cgcgcaggcc gcccagcggc

     5341 aacgcatcga ggcagaagca cgccccggtg aatcgtggca agcggccgct gatcgaatcc

     5401 gcaaagaatc ccggcaaccg ccggcagccg gtgcgccgtc gattaggaag ccgcccaagg

     5461 gcgacgagca accagatttt ttcgttccga tgctctatga cgtgggcacc cgcgatagtc

     5521 gcagcatcat ggacgtggcc gttttccgtc tgtcgaagcg tgaccgacga gctggcgagg

     5581 tgatccgcta cgagcttcca gacgggcacg tagaggtttc cgcagggccg gccggcatgg

     5641 ccagtgtgtg ggattacgac ctggtactga tggcggtttc ccatctaacc gaatccatga

     5701 accgataccg ggaagggaag ggagacaagc ccggccgcgt gttccgtcca cacgttgcgg

     5761 acgtactcaa gttctgccgg cgagccgatg gcggaaagca gaaagacgac ctggtagaaa

     5821 cctgcattcg gttaaacacc acgcacgttg ccatgcagcg tacgaagaag gccaagaacg

     5881 gccgcctggt gacggtatcc gagggtgaag ccttgattag ccgctacaag atcgtaaaga

     5941 gcgaaaccgg gcggccggag tacatcgaga tcgagctagc tgattggatg taccgcgaga

     6001 tcacagaagg caagaacccg gacgtgctga cggttcaccc cgattacttt ttgatcgatc

     6061 ccggcatcgg ccgttttctc taccgcctgg cacgccgcgc cgcaggcaag gcagaagcca

     6121 gatggttgtt caagacgatc tacgaacgca gtggcagcgc cggagagttc aagaagttct

     6181 gtttcaccgt gcgcaagctg atcgggtcaa atgacctgcc ggagtacgat ttgaaggagg

     6241 aggcggggca ggctggcccg atcctagtca tgcgctaccg caacctgatc gagggcgaag

     6301 catccgccgg ttcctaatgt acggagcaga tgctagggca aattgcccta gcaggggaaa

     6361 aaggtcgaaa aggtctcttt cctgtggata gcacgtacat tgggaaccca aagccgtaca

     6421 ttgggaaccg gaacccgtac attgggaacc caaagccgta cattgggaac cggtcacaca

     6481 tgtaagtgac tgatataaaa gagaaaaaag gcgatttttc cgcctaaaac tctttaaaac

     6541 ttattaaaac tcttaaaacc cgcctggcct gtgcataact gtctggccag cgcacagccg

     6601 aagagctgca aaaagcgcct acccttcggt cgctgcgctc cctacgcccc gccgcttcgc

     6661 gtcggcctat cgcggccgct ggccgctcaa aaatggctgg cctacggcca ggcaatctac

     6721 cagggcgcgg acaagccgcg ccgtcgccac tcgaccgccg gcgcccacat caaggcaccc

     6781 tgcctcgcgc gtttcggtga tgacggtgaa aacctctgac acatgcagct cccggagacg

     6841 gtcacagctt gtctgtaagc ggatgccggg agcagacaag cccgtcaggg cgcgtcagcg

     6901 ggtgttggcg ggtgtcgggg cgcagccatg acccagtcac gtagcgatag cggagtgtat

     6961 actggcttaa ctatgcggca tcagagcaga ttgtactgag agtgcaccat atgcggtgtg

     7021 aaataccgca cagatgcgta aggagaaaat accgcatcag gcgctcttcc gcttcctcgc

     7081 tcactgactc gctgcgctcg gtcgttcggc tgcggcgagc ggtatcagct cactcaaagg

     7141 cggtaatacg gttatccaca gaatcagggg ataacgcagg aaagaacatg tgagcaaaag

     7201 gccagcaaaa ggccaggaac cgtaaaaagg ccgcgttgct ggcgtttttc cataggctcc

     7261 gcccccctga cgagcatcac aaaaatcgac gctcaagtca gaggtggcga aacccgacag

     7321 gactataaag ataccaggcg tttccccctg gaagctccct cgtgcgctct cctgttccga

     7381 ccctgccgct taccggatac ctgtccgcct ttctcccttc gggaagcgtg gcgctttctc

     7441 atagctcacg ctgtaggtat ctcagttcgg tgtaggtcgt tcgctccaag ctgggctgtg

     7501 tgcacgaacc ccccgttcag cccgaccgct gcgccttatc cggtaactat cgtcttgagt

     7561 ccaacccggt aagacacgac ttatcgccac tggcagcagc cactggtaac aggattagca

     7621 gagcgaggta tgtaggcggt gctacagagt tcttgaagtg gtggcctaac tacggctaca

     7681 ctagaaggac agtatttggt atctgcgctc tgctgaagcc agttaccttc ggaaaaagag

     7741 ttggtagctc ttgatccggc aaacaaacca ccgctggtag cggtggtttt tttgtttgca

     7801 agcagcagat tacgcgcaga aaaaaaggat ctcaagaaga tcctttgatc ttttctacgg

     7861 ggtctgacgc tcagtggaac gaaaactcac gttaagggat tttggtcatg cattctaggt

     7921 actaaaacaa ttcatccagt aaaatataat attttatttt ctcccaatca ggcttgatcc

     7981 ccagtaagtc aaaaaatagc tcgacatact gttcttcccc gatatcctcc ctgatcgacc

     8041 ggacgcagaa ggcaatgtca taccacttgt ccgccctgcc gcttctccca agatcaataa

     8101 agccacttac tttgccatct ttcacaaaga tgttgctgtc tcccaggtcg ccgtgggaaa

     8161 agacaagttc ctcttcgggc ttttccgtct ttaaaaaatc atacagctcg cgcggatctt

     8221 taaatggagt gtcttcttcc cagttttcgc aatccacatc ggccagatcg ttattcagta

     8281 agtaatccaa ttcggctaag cggctgtcta agctattcgt atagggacaa tccgatatgt

     8341 cgatggagtg aaagagcctg atgcactccg catacagctc gataatcttt tcagggcttt

     8401 gttcatcttc atactcttcc gagcaaagga cgccatcggc ctcactcatg agcagattgc

     8461 tccagccatc atgccgttca aagtgcagga cctttggaac aggcagcttt ccttccagcc

     8521 atagcatcat gtccttttcc cgttccacat cataggtggt ccctttatac cggctgtccg

     8581 tcatttttaa atataggttt tcattttctc ccaccagctt atatacctta gcaggagaca

     8641 ttccttccgt atcttttacg cagcggtatt tttcgatcag ttttttcaat tccggtgata

     8701 ttctcatttt agccatttat tatttccttc ctcttttcta cagtatttaa agatacccca

     8761 agaagctaat tataacaaga cgaactccaa ttcactgttc cttgcattct aaaaccttaa

     8821 ataccagaaa acagcttttt caaagttgtt ttcaaagttg gcgtataaca tagtatcgac

     8881 ggagccgatt ttgaaaccgc ggtgatcaca ggcagcaacg ctctgtcatc gttacaatca

     8941 acatgctacc ctccgcgaga tcatccgtgt ttcaaacccg gcagcttagt tgccgttctt

     9001 ccgaatagca tcggtaacat gagcaaagtc tgccgcctta caacggctct cccgctgacg

     9061 ccgtcccgga ctgatgggct gcctgtatcg agtggtgatt ttgtgccgag ctgccggtcg

     9121 gggagctgtt ggctggctgg tggcaggata tattgtggtg taaacaaatt gacgcttaga

     9181 caacttaata acacattgcg gacgttttta atgtactgaa ttaacgccga attaattcgg

     9241 gggatctgga ttttagtact ggattttggt tttaggaatt agaaatttta ttgatagaag

     9301 tattttacaa atacaaatac atactaaggg tttcttatat gctcaacaca tgagcgaaac

     9361 cctataggaa ccctaattcc cttatctggg aactactcac acattattat ggagaaactc

     9421 gaggcattgc agatgagctg tatctggaag aggtaaaccc gaaacgcgtt ttattcttgt

     9481 tgacatggag ctattaaatc actagaaggc actctttgct gcttggacaa atgaacgtat

     9541 cttatcgaga tcctgaacac catttgtctc aactccggag ctgacatcga caccaacgat

     9601 cttatatcca gattcgtcaa gctgtttgat gatttcagta acgttaagtg gatcatgata

     9661 atcatcgcaa gaccggcaac aggattcaat cttaagaaac tttattgcca aatgtttgaa

     9721 cgatctgcag gtcgacggac tatttctttg ccctcggacg agtgctgggg cgtcggtttc

     9781 cactatcggc gagtacttct acacagccat cggtccagac ggccgcgctt ctgcgggcga

     9841 tttgtgtacg cccgacagtc ccggctccgg atcggacgat tgcgtcgcat cgaccctgcg

     9901 cccaagctgc atcatcgaaa ttgccgtcaa ccaagctctg atagagttgg tcaagaccaa

     9961 tgcggagcat atacgcccgg agtcgtggcg atcctgcaag ctccggatgc ctccgctcga

    10021 agtagcgcgt ctgctgctcc atacaagcca accacggcct ccagaagaag atgttggcga

    10081 cctcgtattg ggaatccccg aacatcgcct cgctccagtc aatgaccgct gttatgcggc

    10141 cattgtccgt caggacattg ttggagccga aatccgcgtg cacgaggtgc cggacttcgg

    10201 ggcagtcctc ggcccaaagc atcagctcat cgagagcctg cgcgacggac gcactgacgg

    10261 tgtcgtccat cacagtttgc cagtgataca catggggatc agcaatcgcg catatgaaat

    10321 cacgccatgt agtgtattga ccgattcctt gcggtccgaa tgggccgaac ccgctcgtct

    10381 ggctaagatc ggccgcagcg atcgcatcca tagcctccgc gaccggttgt agaacagcgg

    10441 gcagttcggt ttcaggcagg tcttgcaacg tgacaccctg tgcacggcgg gagatgcaat

    10501 aggtcaggct ctcgctaaac tccccaatgt caagcacttc cggaatcggg agcgcggccg

    10561 atgcaaagtg ccgataaaca taacgatctt tgtagaaacc atcggcgcag ctatttaccc

    10621 gcaggacata tccacgccct cctacatcga agctgaaagc acgagattct tcgccctccg

    10681 agagctgcat caggtcggag acgctgtcga acttttcgat cagaaacttc tcgacagacg

    10741 tcgcggtgag ttcaggcttt ttcatggtta cttcctaatc gaagctttgc ttgggtagaa

    10801 taggtaagtc agattgaatc tgaaataaag ggaggaaggg cgaacttaag aaggtatgac

    10861 cgggtcgttc acttaccttg cttgacaaac gcaccaagtt atcgtgcacc aagcagcaga

    10921 tgataataat gtcctcgttc ctgtctgcta ataagagtca cacttcgagc gccgccgcta

    10981 ctgctacaag tggggctgat ctgaccagtt gcctaaatga accatcttgt caaacgacac

    11041 aaattttgtg ctcaccgcct ggacgactaa accaaaatag gcattcattg ttgacctcca

    11101 ctagctccag ccaagcccaa aaagtgctcc ttcaatatca tcttctgtcg agtctagagc

    11161 acattctgcg gcctctgtgc tctgcaagcc gcaaactttc accaatggac cagaactacc

    11221 tgtgaaatta ataacagaca tactccaagc tgcctttgtg tgcttaatca cgtatactca

    11281 cgtgctcaat agtcaccaat gccctccctc ttggccctct ccttttcttt tttcgaccga

    11341 attgagctcg gtaccaaacg ttgctagcag ttccaggtgg aatgttatga tgagcattgt

    11401 attaaatcag gagatatagc atgatctcta gttagctcac cacaaaagtc agacggcgta

    11461 accaaaagtc acacaacaca agctgtaagg atttcggcac ggctacggaa gacggagaag

    11521 ccaccttcag tggactcgag taccatttaa ttctatttgt gtttgatcga gacctaatac

    11581 agcccctaca acgaccatca aagtcgtata gctaccagtg aggaagtgga ctcaaatcga

    11641 cttcagcaac atctcctgga taaactttaa gcctaaacta tacagaataa gataggtgga

    11701 gagcttatac cgagctccca aatctgtcca gatcatggtt gaccggtgcc tggatcttcc

    11761 tatagaatca tccttattcg ttgacctagc tgattctgga gtgacccaga gggtcatgac

    11821 ttgagcctaa aatccgccgc ctccaccatt tgtagaaaaa tgtgacgaac tcgtgagctc

    11881 tgtacagtga ccggtgactc tttctggcat gcggagagac ggacggacgc agagagaagg

    11941 gctgagtaat aagccactgg ccagacagct ctggcggctc tgaggtgcag tggatgatta

    12001 ttaatccggg accggccgcc cctccgcccc gaagtggaaa ggctggtgtg cccctcgttg

    12061 accaagaatc tattgcatca tcggagaata tggagcttca tcgaatcacc ggcagtaagc

    12121 gaaggagaat gtgaagccag gggtgtatag ccgtcggcga aatagcatgc cattaaccta

    12181 ggtacagaag tccaattgct tccgatctgg taaaagattc acgagatagt accttctccg

    12241 aagtaggtag agcgagtacc cggcgcgtaa gctccctaat tggcccatcc ggcatctgta

    12301 gggcgtccaa atatcgtgcc tctcctgctt tgcccggtgt atgaaaccgg aaaggccgct

    12361 caggagctgg ccagcggcgc agaccgggaa cacaagctgg cagtcgaccc atccggtgct

    12421 ctgcactcga cctgctgagg tccctcagtc cctggtaggc agctttgccc cgtctgtccg

    12481 cccggtgtgt cggcggggtt gacaaggtcg ttgcgtcagt ccaacatttg ttgccatatt

    12541 ttcctgctct ccccaccagc tgctcttttc ttttctcttt cttttcccat cttcagtata

    12601 ttcatcttcc catccaagaa cctttatttc ccctaagtaa gtactttgct acatccatac

    12661 tccatccttc ccatccctta ttcctttgaa cctttcagtt cgagctttcc cacttcatcg

    12721 cagcttgact aacagctacc ccgcttgagc agacatcacc atggt

//

No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart