pCambia1391Z

$356.00

  • Model: PVTH0002
  • 50 Units in Stock
Ask a question


Add to Cart:

pCambia1391Z

 

Alternative Name

pCambia 1391Z, pCambia 1391Z Vector, pCambia 1391Z Plasmid, pCambia 1391Z map

 

pCambia1391Z Information

Plasmid type: plant expression vector

High copy / low copy: low copy

Promoter: CAMV 35S

Cloning methods: polyclonal sites, restrictive endonucleases

Carrier size: 11227 BP

5'sequencing primers and sequences: M13-F: TGTAAAACGACGGCCAGT

3'sequencing primers and sequences: M13-R: CAGGAAACAGCTATGAC

Carrier label: GusA

Carrier resistance: kanana and Hygromycin

Screening markers: HPTII

Note: -

Stability: stable expression

Composition type: non group molding

Virus / non virus: non virus

 

pCambia1391Z Sequence

LOCUS       pCAMBIA1391Z          11227 bp ds-DNA    circular SYN 

DEFINITION  Agrobacterium binary vector for plant transformation, with 

            hygromycin- and kanamycin-resistance and LacZ-GUS genes plus the 

            pUC9 MCS.

ACCESSION   AF234312

VERSION     .

KEYWORDS    pCAMBIA1391Z

SOURCE      synthetic DNA construct

  ORGANISM  synthetic DNA construct

REFERENCE   1  (bases 1 to 11227)

  AUTHORS   Cambia

  TITLE     Direct Submission

  JOURNAL   Exported from SnapGene Viewer 

COMMENT     The GenBank record was corrected by inserting a G at position 4743.

FEATURES             Location/Qualifiers

     source          1..11227

                     /organism="synthetic DNA construct"

                     /lab_host="Plant Cells"

                     /mol_type="other DNA"

     CDS             join(2..16,207..2024)

                     /codon_start=1

                     /product="beta-glucuronidase"

                     /label="GUS"

                     /label="This version of the gusA gene has a 5' extension 

                     with a catalase intron to ensure expression in plants but 

                     not bacteria."

                     /protein_id="

                     "                    

     intron          17..206

                     /label="cat1 intron"

                     /label="castor bean catalase intron, modified"

     CDS             2031..2048

                     /codon_start=1

                     /product="6xHis affinity tag"

                     /label="6xHis"

                     /translation="HHHHHH"

     terminator      2083..2335

                     /label="NOS terminator"

                     /label="nopaline synthase terminator and poly(A) signal"

     misc_feature    2357..2381

                     /label="RB T-DNA repeat"

                     /label="right border repeat from nopaline C58 T-DNA"

     CDS             3681..4310

                     /codon_start=1

                     /product="stability protein from Pseudomonas plasmid pVS1"

                     /label="pVS1 StaA"                     

     CDS             4739..5812

                     /codon_start=1

                     /product="replication protein from Pseudomonas plasmid 

                     pVS1"

                     /label="pVS1 RepA"

                     /label="

                     "

                     /protein_id="

                     "                     

     misc_feature    6416..6556

                     /label="bom"

                     /label="basis of mobility region from pBR322"

     rep_origin      complement(6742..7330)

                     /direction=LEFT

                     /label="ori"

                     /label="high-copy-number ColE1/pMB1/pBR322/pUC origin of 

                     replication"

     CDS             complement(7417..8211)

                     /codon_start=1

                     /gene="aphA-3"

                     /product="aminoglycoside phosphotransferase"

                     /label="KanR"

                     /label="confers resistance to kanamycin"

                     /protein_id="

                     "

     misc_feature    8636..8660

                     /label="LB T-DNA repeat"

                     /label="left border repeat from nopaline C58 T-DNA"

     polyA_signal    8738..8912

                     /label="CaMV poly(A) signal"

                     /label="cauliflower mosaic virus polyadenylation signal"

     CDS             complement(8952..9977)

                     /codon_start=1

                     /product="hygromycin B phosphotransferase"

                     /label="HygR"

                     /label="confers resistance to hygromycin"                     

     promoter        complement(10045..10722)

                     /label="CaMV 35S promoter (enhanced)"

                     /label="cauliflower mosaic virus 35S promoter with a 

                     duplicated enhancer region"

     promoter        10936..10966

                     /label="lac promoter"

                     /label="promoter for the E. coli lac operon"

     protein_bind    10974..10990

                     /bound_moiety="lac repressor encoded by lacI"

                     /label="lac operator"

                     /label="The lac repressor binds to the lac operator to 

                     inhibit transcription in E. coli. This inhibition can be 

                     relieved by adding lactose or 

                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."

     primer_bind     10998..11014

                     /label="M13 rev"

                     /label="common sequencing primer, one of multiple similar 

                     variants"

     CDS             11010..11207

                     /codon_start=1

                     /gene="lacZ (fragment)"

                     /product="LacZ-alpha fragment of?beta-galactosidase"

                     /label="lacZ-alpha"

                     /protein_id="

                     "

                     /translation="MTMITPSLAAGRRIPGNSLAVVLQRRDWENPGVTQLNRLAAHPPF

                     ASWRNSEEARTDRPSQQLRSL"

     misc_feature    11027..11062

                     /label="MCS"

                     /label="multiple cloning site from pUC9"

     primer_bind     complement(11063..11079)

                     /label="M13 fwd"

                     /label="common sequencing primer, one of multiple similar 

                     variants"

ORIGIN

        1 catggtagat ctgagggtaa atttctagtt tttctccttc attttcttgg ttaggaccct

       61 tttctctttt tatttttttg agctttgatc tttctttaaa ctgatctatt ttttaattga

      121 ttggttatgg tgtaaatatt acatagcttt aactgataat ctgattactt tatttcgtgt

      181 gtctatgatg atgatgatag ttacagaacc gacgactcgt ccgtcctgta gaaaccccaa

      241 cccgtgaaat caaaaaactc gacggcctgt gggcattcag tctggatcgc gaaaactgtg

      301 gaattgatca gcgttggtgg gaaagcgcgt tacaagaaag ccgggcaatt gctgtgccag

      361 gcagttttaa cgatcagttc gccgatgcag atattcgtaa ttatgcgggc aacgtctggt

      421 atcagcgcga agtctttata ccgaaaggtt gggcaggcca gcgtatcgtg ctgcgtttcg

      481 atgcggtcac tcattacggc aaagtgtggg tcaataatca ggaagtgatg gagcatcagg

      541 gcggctatac gccatttgaa gccgatgtca cgccgtatgt tattgccggg aaaagtgtac

      601 gtatcaccgt ttgtgtgaac aacgaactga actggcagac tatcccgccg ggaatggtga

      661 ttaccgacga aaacggcaag aaaaagcagt cttacttcca tgatttcttt aactatgccg

      721 gaatccatcg cagcgtaatg ctctacacca cgccgaacac ctgggtggac gatatcaccg

      781 tggtgacgca tgtcgcgcaa gactgtaacc acgcgtctgt tgactggcag gtggtggcca

      841 atggtgatgt cagcgttgaa ctgcgtgatg cggatcaaca ggtggttgca actggacaag

      901 gcactagcgg gactttgcaa gtggtgaatc cgcacctctg gcaaccgggt gaaggttatc

      961 tctatgaact cgaagtcaca gccaaaagcc agacagagtc tgatatctac ccgcttcgcg

     1021 tcggcatccg gtcagtggca gtgaagggcc aacagttcct gattaaccac aaaccgttct

     1081 actttactgg ctttggtcgt catgaagatg cggacttacg tggcaaagga ttcgataacg

     1141 tgctgatggt gcacgaccac gcattaatgg actggattgg ggccaactcc taccgtacct

     1201 cgcattaccc ttacgctgaa gagatgctcg actgggcaga tgaacatggc atcgtggtga

     1261 ttgatgaaac tgctgctgtc ggctttcagc tgtctttagg cattggtttc gaagcgggca

     1321 acaagccgaa agaactgtac agcgaagagg cagtcaacgg ggaaactcag caagcgcact

     1381 tacaggcgat taaagagctg atagcgcgtg acaaaaacca cccaagcgtg gtgatgtgga

     1441 gtattgccaa cgaaccggat acccgtccgc aaggtgcacg ggaatatttc gcgccactgg

     1501 cggaagcaac gcgtaaactc gacccgacgc gtccgatcac ctgcgtcaat gtaatgttct

     1561 gcgacgctca caccgatacc atcagcgatc tctttgatgt gctgtgcctg aaccgttatt

     1621 acggatggta tgtccaaagc ggcgatttgg aaacggcaga gaaggtactg gaaaaagaac

     1681 ttctggcctg gcaggagaaa ctgcatcagc cgattatcat caccgaatac ggcgtggata

     1741 cgttagccgg gctgcactca atgtacaccg acatgtggag tgaagagtat cagtgtgcat

     1801 ggctggatat gtatcaccgc gtctttgatc gcgtcagcgc cgtcgtcggt gaacaggtat

     1861 ggaatttcgc cgattttgcg acctcgcaag gcatattgcg cgttggcggt aacaagaaag

     1921 ggatcttcac tcgcgaccgc aaaccgaagt cggcggcttt tctgctgcaa aaacgctgga

     1981 ctggcatgaa cttcggtgaa aaaccgcagc agggaggcaa acaagctagc caccaccacc

     2041 accaccacgt gtgaattaca ggtgaccagc tcgaatttcc ccgatcgttc aaacatttgg

     2101 caataaagtt tcttaagatt gaatcctgtt gccggtcttg cgatgattat catataattt

     2161 ctgttgaatt acgttaagca tgtaataatt aacatgtaat gcatgacgtt atttatgaga

     2221 tgggttttta tgattagagt cccgcaatta tacatttaat acgcgataga aaacaaaata

     2281 tagcgcgcaa actaggataa attatcgcgc gcggtgtcat ctatgttact agatcgggaa

     2341 ttaaactatc agtgtttgac aggatatatt ggcgggtaaa cctaagagaa aagagcgttt

     2401 attagaataa cggatattta aaagggcgtg aaaaggttta tccgttcgtc catttgtatg

     2461 tgcatgccaa ccacagggtt cccctcggga tcaaagtact ttgatccaac ccctccgctg

     2521 ctatagtgca gtcggcttct gacgttcagt gcagccgtct tctgaaaacg acatgtcgca

     2581 caagtcctaa gttacgcgac aggctgccgc cctgcccttt tcctggcgtt ttcttgtcgc

     2641 gtgttttagt cgcataaagt agaatacttg cgactagaac cggagacatt acgccatgaa

     2701 caagagcgcc gccgctggcc tgctgggcta tgcccgcgtc agcaccgacg accaggactt

     2761 gaccaaccaa cgggccgaac tgcacgcggc cggctgcacc aagctgtttt ccgagaagat

     2821 caccggcacc aggcgcgacc gcccggagct ggccaggatg cttgaccacc tacgccctgg

     2881 cgacgttgtg acagtgacca ggctagaccg cctggcccgc agcacccgcg acctactgga

     2941 cattgccgag cgcatccagg aggccggcgc gggcctgcgt agcctggcag agccgtgggc

     3001 cgacaccacc acgccggccg gccgcatggt gttgaccgtg ttcgccggca ttgccgagtt

     3061 cgagcgttcc ctaatcatcg accgcacccg gagcgggcgc gaggccgcca aggcccgagg

     3121 cgtgaagttt ggcccccgcc ctaccctcac cccggcacag atcgcgcacg cccgcgagct

     3181 gatcgaccag gaaggccgca ccgtgaaaga ggcggctgca ctgcttggcg tgcatcgctc

     3241 gaccctgtac cgcgcacttg agcgcagcga ggaagtgacg cccaccgagg ccaggcggcg

     3301 cggtgccttc cgtgaggacg cattgaccga ggccgacgcc ctggcggccg ccgagaatga

     3361 acgccaagag gaacaagcat gaaaccgcac caggacggcc aggacgaacc gtttttcatt

     3421 accgaagaga tcgaggcgga gatgatcgcg gccgggtacg tgttcgagcc gcccgcgcac

     3481 gtctcaaccg tgcggctgca tgaaatcctg gccggtttgt ctgatgccaa gctggcggcc

     3541 tggccggcca gcttggccgc tgaagaaacc gagcgccgcc gtctaaaaag gtgatgtgta

     3601 tttgagtaaa acagcttgcg tcatgcggtc gctgcgtata tgatgcgatg agtaaataaa

     3661 caaatacgca aggggaacgc atgaaggtta tcgctgtact taaccagaaa ggcgggtcag

     3721 gcaagacgac catcgcaacc catctagccc gcgccctgca actcgccggg gccgatgttc

     3781 tgttagtcga ttccgatccc cagggcagtg cccgcgattg ggcggccgtg cgggaagatc

     3841 aaccgctaac cgttgtcggc atcgaccgcc cgacgattga ccgcgacgtg aaggccatcg

     3901 gccggcgcga cttcgtagtg atcgacggag cgccccaggc ggcggacttg gctgtgtccg

     3961 cgatcaaggc agccgacttc gtgctgattc cggtgcagcc aagcccttac gacatatggg

     4021 ccaccgccga cctggtggag ctggttaagc agcgcattga ggtcacggat ggaaggctac

     4081 aagcggcctt tgtcgtgtcg cgggcgatca aaggcacgcg catcggcggt gaggttgccg

     4141 aggcgctggc cgggtacgag ctgcccattc ttgagtcccg tatcacgcag cgcgtgagct

     4201 acccaggcac tgccgccgcc ggcacaaccg ttcttgaatc agaacccgag ggcgacgctg

     4261 cccgcgaggt ccaggcgctg gccgctgaaa ttaaatcaaa actcatttga gttaatgagg

     4321 taaagagaaa atgagcaaaa gcacaaacac gctaagtgcc ggccgtccga gcgcacgcag

     4381 cagcaaggct gcaacgttgg ccagcctggc agacacgcca gccatgaagc gggtcaactt

     4441 tcagttgccg gcggaggatc acaccaagct gaagatgtac gcggtacgcc aaggcaagac

     4501 cattaccgag ctgctatctg aatacatcgc gcagctacca gagtaaatga gcaaatgaat

     4561 aaatgagtag atgaatttta gcggctaaag gaggcggcat ggaaaatcaa gaacaaccag

     4621 gcaccgacgc cgtggaatgc cccatgtgtg gaggaacggg cggttggcca ggcgtaagcg

     4681 gctgggttgt ctgccggccc tgcaatggca ctggaacccc caagcccgag gaatcggcgt

     4741 gagcggtcgc aaaccatccg gcccggtaca aatcggcgcg gcgctgggtg atgacctggt

     4801 ggagaagttg aaggccgcgc aggccgccca gcggcaacgc atcgaggcag aagcacgccc

     4861 cggtgaatcg tggcaagcgg ccgctgatcg aatccgcaaa gaatcccggc aaccgccggc

     4921 agccggtgcg ccgtcgatta ggaagccgcc caagggcgac gagcaaccag attttttcgt

     4981 tccgatgctc tatgacgtgg gcacccgcga tagtcgcagc atcatggacg tggccgtttt

     5041 ccgtctgtcg aagcgtgacc gacgagctgg cgaggtgatc cgctacgagc ttccagacgg

     5101 gcacgtagag gtttccgcag ggccggccgg catggccagt gtgtgggatt acgacctggt

     5161 actgatggcg gtttcccatc taaccgaatc catgaaccga taccgggaag ggaagggaga

     5221 caagcccggc cgcgtgttcc gtccacacgt tgcggacgta ctcaagttct gccggcgagc

     5281 cgatggcgga aagcagaaag acgacctggt agaaacctgc attcggttaa acaccacgca

     5341 cgttgccatg cagcgtacga agaaggccaa gaacggccgc ctggtgacgg tatccgaggg

     5401 tgaagccttg attagccgct acaagatcgt aaagagcgaa accgggcggc cggagtacat

     5461 cgagatcgag ctagctgatt ggatgtaccg cgagatcaca gaaggcaaga acccggacgt

     5521 gctgacggtt caccccgatt actttttgat cgatcccggc atcggccgtt ttctctaccg

     5581 cctggcacgc cgcgccgcag gcaaggcaga agccagatgg ttgttcaaga cgatctacga

     5641 acgcagtggc agcgccggag agttcaagaa gttctgtttc accgtgcgca agctgatcgg

     5701 gtcaaatgac ctgccggagt acgatttgaa ggaggaggcg gggcaggctg gcccgatcct

     5761 agtcatgcgc taccgcaacc tgatcgaggg cgaagcatcc gccggttcct aatgtacgga

     5821 gcagatgcta gggcaaattg ccctagcagg ggaaaaaggt cgaaaaggtc tctttcctgt

     5881 ggatagcacg tacattggga acccaaagcc gtacattggg aaccggaacc cgtacattgg

     5941 gaacccaaag ccgtacattg ggaaccggtc acacatgtaa gtgactgata taaaagagaa

     6001 aaaaggcgat ttttccgcct aaaactcttt aaaacttatt aaaactctta aaacccgcct

     6061 ggcctgtgca taactgtctg gccagcgcac agccgaagag ctgcaaaaag cgcctaccct

     6121 tcggtcgctg cgctccctac gccccgccgc ttcgcgtcgg cctatcgcgg ccgctggccg

     6181 ctcaaaaatg gctggcctac ggccaggcaa tctaccaggg cgcggacaag ccgcgccgtc

     6241 gccactcgac cgccggcgcc cacatcaagg caccctgcct cgcgcgtttc ggtgatgacg

     6301 gtgaaaacct ctgacacatg cagctcccgg agacggtcac agcttgtctg taagcggatg

No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart