pCAMBIA3301

$216.00

  • Model: PVT3023
  • 49 Units in Stock
Ask a question


Add to Cart:

pCAMBIA3301

PVT3023         2ug
 

 

pCAMBIA3301 Informaiton

Promoter: Lac, CaMV 35S

Replicon: pVS1 oriV, ori

Terminator: NOS

Plasmid classification: plant series, protein overexpression vector

Plasmid size: 11319bp

Prokaryotic resistance: Kan

Selection marker: Bar

Clonal strain: DH5 alpha

Culture conditions: 37 C, aerobic LB

Expression host: plant cells

5'sequencing primers: M13F:TGTAAAACGACGGCCAGT

Primers for 3'sequencing: primers designed based on sequences

Use: Plant expression

 

pCAMBIA3301 Multiple cloning site

pCAMBIA3301-vector

 

pCAMBIA3301 Sequence

LOCUS       Exported               11319 bp ds-DNA     circular SYN 12-MAY-2016

DEFINITION  synthetic circular DNA

KEYWORDS    Untitled

SOURCE      synthetic DNA construct

  ORGANISM  synthetic DNA construct

REFERENCE   1  (bases 1 to 11319)

  AUTHORS   .

  TITLE     Direct Submission

FEATURES             Location/Qualifiers

     source          1..11319

                     /organism="synthetic DNA construct"

                     /mol_type="other DNA"

     CDS             join(2..16,207..2024)

                     /codon_start=1

                     /product="beta-glucuronidase"

                     /note="GUS"

                     /note="This version of the gusA gene has a 5' extension 

                     with a catalase intron to ensure expression in plants but 

                     not bacteria."

                     /translation="MVDLRNRRLVRPVETPTREIKKLDGLWAFSLDRENCGIDQRWWES

                     ALQESRAIAVPGSFNDQFADADIRNYAGNVWYQREVFIPKGWAGQRIVLRFDAVTHYGK

                     VWVNNQEVMEHQGGYTPFEADVTPYVIAGKSVRITVCVNNELNWQTIPPGMVITDENGK

                     KKQSYFHDFFNYAGIHRSVMLYTTPNTWVDDITVVTHVAQDCNHASVDWQVVANGDVSV

                     ELRDADQQVVATGQGTSGTLQVVNPHLWQPGEGYLYELEVTAKSQTESDIYPLRVGIRS

                     VAVKGQQFLINHKPFYFTGFGRHEDADLRGKGFDNVLMVHDHALMDWIGANSYRTSHYP

                     YAEEMLDWADEHGIVVIDETAAVGFQLSLGIGFEAGNKPKELYSEEAVNGETQQAHLQA

                     IKELIARDKNHPSVVMWSIANEPDTRPQGAREYFAPLAEATRKLDPTRPITCVNVMFCD

                     AHTDTISDLFDVLCLNRYYGWYVQSGDLETAEKVLEKELLAWQEKLHQPIIITEYGVDT

                     LAGLHSMYTDMWSEEYQCAWLDMYHRVFDRVSAVVGEQVWNFADFATSQGILRVGGNKK

                     GIFTRDRKPKSAAFLLQKRWTGMNFGEKPQQGGKQ"

     intron          17..206

                     /note="cat1 intron"

                     /note="castor bean catalase intron, modified"

     CDS             2031..2048

                     /codon_start=1

                     /product="6xHis affinity tag"

                     /note="6xHis"

                     /translation="HHHHHH"

     terminator      2083..2335

                     /note="NOS terminator"

                     /note="nopaline synthase terminator and poly(A) signal"

     misc_feature    2357..2381

                     /note="RB T-DNA repeat"

                     /note="right border repeat from nopaline C58 T-DNA"

     CDS             3681..4310

                     /codon_start=1

                     /product="stability protein from the Pseudomonas plasmid 

                     pVS1 (Heeb et al., 2000)"

                     /note="pVS1 StaA"

                     /translation="MKVIAVLNQKGGSGKTTIATHLARALQLAGADVLLVDSDPQGSAR

                     DWAAVREDQPLTVVGIDRPTIDRDVKAIGRRDFVVIDGAPQAADLAVSAIKAADFVLIP

                     VQPSPYDIWATADLVELVKQRIEVTDGRLQAAFVVSRAIKGTRIGGEVAEALAGYELPI

                     LESRITQRVSYPGTAAAGTTVLESEPEGDAAREVQALAAEIKSKLI"

     CDS             4744..5811

                     /codon_start=1

                     /product="replication protein from the Pseudomonas plasmid 

                     pVS1 (Heeb et al., 2000)"

                     /note="pVS1 RepA"

                     /translation="GRKPSGPVQIGAALGDDLVEKLKAAQAAQRQRIEAEARPGESWQA

                     AADRIRKESRQPPAAGAPSIRKPPKGDEQPDFFVPMLYDVGTRDSRSIMDVAVFRLSKR

                     DRRAGEVIRYELPDGHVEVSAGPAGMASVWDYDLVLMAVSHLTESMNRYREGKGDKPGR

                     VFRPHVADVLKFCRRADGGKQKDDLVETCIRLNTTHVAMQRTKKAKNGRLVTVSEGEAL

                     ISRYKIVKSETGRPEYIEIELADWMYREITEGKNPDVLTVHPDYFLIDPGIGRFLYRLA

                     RRAAGKAEARWLFKTIYERSGSAGEFKKFCFTVRKLIGSNDLPEYDLKEEAGQAGPILV

                     MRYRNLIEGEASAGS"

     rep_origin      5877..6071

                     /note="pVS1 oriV"

                     /note="origin of replication for the Pseudomonas plasmid 

                     pVS1 (Heeb et al., 2000)"

     misc_feature    6415..6555

                     /note="bom"

                     /note="basis of mobility region from pBR322"

     rep_origin      complement(6741..7329)

                     /direction=LEFT

                     /note="ori"

                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 

                     replication"

     CDS             complement(7416..8210)

                     /codon_start=1

                     /gene="aphA-3"

                     /product="aminoglycoside phosphotransferase"

                     /note="KanR"

                     /note="confers resistance to kanamycin"

                     /translation="MAKMRISPELKKLIEKYRCVKDTEGMSPAKVYKLVGENENLYLKM

                     TDSRYKGTTYDVEREKDMMLWLEGKLPVPKVLHFERHDGWSNLLMSEADGVLCSEEYED

                     EQSPEKIIELYAECIRLFHSIDISDCPYTNSLDSRLAELDYLLNNDLADVDCENWEEDT

                     PFKDPRELYDFLKTEKPEEELVFSHGDLGDSNIFVKDGKVSGFIDLGRSGRADKWYDIA

                     FCVRSIREDIGEEQYVELFFDLLGIKPDWEKIKYYILLDELF"

     misc_feature    8635..8659

                     /note="LB T-DNA repeat"

                     /note="left border repeat from nopaline C58 T-DNA"

     polyA_signal    8737..8911

                     /note="CaMV poly(A) signal"

                     /note="cauliflower mosaic virus polyadenylation signal"

     CDS             complement(8918..9469)

                     /codon_start=1

                     /gene="Streptomyces hygroscopicus bar"

                     /product="phosphinothricin acetyltransferase"

                     /note="BlpR"

                     /note="confers resistance to bialophos or phosphinothricin"

                     /translation="MSPERRPADIRRATEADMPAVCTIVNHYIETSTVNFRTEPQEPQE

                     WTDDLVRLRERYPWLVAEVDGEVAGIAYAGPWKARNAYDWTAESTVYVSPRHQRTGLGS

                     TLYTHLLKSLEAQGFKSVVAVIGLPNDPSVRMHEALGYAPRGMLRAAGFKHGNWHDVGF

                     WQLDFSLPVPPRPVLPVTEI"

     promoter        complement(9514..10191)

                     /note="CaMV 35S promoter (enhanced)"

                     /note="cauliflower mosaic virus 35S promoter with a 

                     duplicated enhancer region"

     protein_bind    10382..10403

                     /bound_moiety="E. coli catabolite activator protein"

                     /note="CAP binding site"

                     /note="CAP binding activates transcription in the presence 

                     of cAMP."

     promoter        10418..10448

                     /note="lac promoter"

                     /note="promoter for the E. coli lac operon"

     protein_bind    10456..10472

                     /bound_moiety="lac repressor encoded by lacI"

                     /note="lac operator"

                     /note="The lac repressor binds to the lac operator to 

                     inhibit transcription in E. coli. This inhibition can be 

                     relieved by adding lactose or 

                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."

     primer_bind     10480..10496

                     /note="M13 rev"

                     /note="common sequencing primer, one of multiple similar 

                     variants"

     CDS             10492..10725

                     /codon_start=1

                     /gene="lacZ fragment"

                     /product="LacZ-alpha fragment of beta-galactosidase"

                     /note="lacZ-alpha"

                     /translation="MTMITNSSSVPGDPLESTCRHASLALAVVLQRRDWENPGVTQLNR

                     LAAHPPFASWRNSEEARTDRPSQQLRSLNGEC"

     misc_feature    10506..10562

                     /note="MCS"

                     /note="pUC18/19 multiple cloning site"

     primer_bind     complement(10566..10582)

                     /note="M13 fwd"

                     /note="common sequencing primer, one of multiple similar 

                     variants"

     promoter        10959..11304

                     /note="CaMV 35S promoter"

                     /note="strong constitutive promoter from cauliflower mosaic

                     virus"

ORIGIN

        1 catggtagat ctgagggtaa atttctagtt tttctccttc attttcttgg ttaggaccct

       61 tttctctttt tatttttttg agctttgatc tttctttaaa ctgatctatt ttttaattga

      121 ttggttatgg tgtaaatatt acatagcttt aactgataat ctgattactt tatttcgtgt

      181 gtctatgatg atgatgatag ttacagaacc gacgactcgt ccgtcctgta gaaaccccaa

      241 cccgtgaaat caaaaaactc gacggcctgt gggcattcag tctggatcgc gaaaactgtg

      301 gaattgatca gcgttggtgg gaaagcgcgt tacaagaaag ccgggcaatt gctgtgccag

      361 gcagttttaa cgatcagttc gccgatgcag atattcgtaa ttatgcgggc aacgtctggt

      421 atcagcgcga agtctttata ccgaaaggtt gggcaggcca gcgtatcgtg ctgcgtttcg

      481 atgcggtcac tcattacggc aaagtgtggg tcaataatca ggaagtgatg gagcatcagg

      541 gcggctatac gccatttgaa gccgatgtca cgccgtatgt tattgccggg aaaagtgtac

      601 gtatcaccgt ttgtgtgaac aacgaactga actggcagac tatcccgccg ggaatggtga

      661 ttaccgacga aaacggcaag aaaaagcagt cttacttcca tgatttcttt aactatgccg

      721 gaatccatcg cagcgtaatg ctctacacca cgccgaacac ctgggtggac gatatcaccg

      781 tggtgacgca tgtcgcgcaa gactgtaacc acgcgtctgt tgactggcag gtggtggcca

      841 atggtgatgt cagcgttgaa ctgcgtgatg cggatcaaca ggtggttgca actggacaag

      901 gcactagcgg gactttgcaa gtggtgaatc cgcacctctg gcaaccgggt gaaggttatc

      961 tctatgaact cgaagtcaca gccaaaagcc agacagagtc tgatatctac ccgcttcgcg

     1021 tcggcatccg gtcagtggca gtgaagggcc aacagttcct gattaaccac aaaccgttct

     1081 actttactgg ctttggtcgt catgaagatg cggacttacg tggcaaagga ttcgataacg

     1141 tgctgatggt gcacgaccac gcattaatgg actggattgg ggccaactcc taccgtacct

     1201 cgcattaccc ttacgctgaa gagatgctcg actgggcaga tgaacatggc atcgtggtga

     1261 ttgatgaaac tgctgctgtc ggctttcagc tgtctttagg cattggtttc gaagcgggca

     1321 acaagccgaa agaactgtac agcgaagagg cagtcaacgg ggaaactcag caagcgcact

     1381 tacaggcgat taaagagctg atagcgcgtg acaaaaacca cccaagcgtg gtgatgtgga

     1441 gtattgccaa cgaaccggat acccgtccgc aaggtgcacg ggaatatttc gcgccactgg

     1501 cggaagcaac gcgtaaactc gacccgacgc gtccgatcac ctgcgtcaat gtaatgttct

     1561 gcgacgctca caccgatacc atcagcgatc tctttgatgt gctgtgcctg aaccgttatt

     1621 acggatggta tgtccaaagc ggcgatttgg aaacggcaga gaaggtactg gaaaaagaac

     1681 ttctggcctg gcaggagaaa ctgcatcagc cgattatcat caccgaatac ggcgtggata

     1741 cgttagccgg gctgcactca atgtacaccg acatgtggag tgaagagtat cagtgtgcat

     1801 ggctggatat gtatcaccgc gtctttgatc gcgtcagcgc cgtcgtcggt gaacaggtat

     1861 ggaatttcgc cgattttgcg acctcgcaag gcatattgcg cgttggcggt aacaagaaag

     1921 ggatcttcac tcgcgaccgc aaaccgaagt cggcggcttt tctgctgcaa aaacgctgga

     1981 ctggcatgaa cttcggtgaa aaaccgcagc agggaggcaa acaagctagc caccaccacc

     2041 accaccacgt gtgaattaca ggtgaccagc tcgaatttcc ccgatcgttc aaacatttgg

     2101 caataaagtt tcttaagatt gaatcctgtt gccggtcttg cgatgattat catataattt

     2161 ctgttgaatt acgttaagca tgtaataatt aacatgtaat gcatgacgtt atttatgaga

     2221 tgggttttta tgattagagt cccgcaatta tacatttaat acgcgataga aaacaaaata

     2281 tagcgcgcaa actaggataa attatcgcgc gcggtgtcat ctatgttact agatcgggaa

     2341 ttaaactatc agtgtttgac aggatatatt ggcgggtaaa cctaagagaa aagagcgttt

     2401 attagaataa cggatattta aaagggcgtg aaaaggttta tccgttcgtc catttgtatg

     2461 tgcatgccaa ccacagggtt cccctcggga tcaaagtact ttgatccaac ccctccgctg

     2521 ctatagtgca gtcggcttct gacgttcagt gcagccgtct tctgaaaacg acatgtcgca

     2581 caagtcctaa gttacgcgac aggctgccgc cctgcccttt tcctggcgtt ttcttgtcgc

     2641 gtgttttagt cgcataaagt agaatacttg cgactagaac cggagacatt acgccatgaa

     2701 caagagcgcc gccgctggcc tgctgggcta tgcccgcgtc agcaccgacg accaggactt

     2761 gaccaaccaa cgggccgaac tgcacgcggc cggctgcacc aagctgtttt ccgagaagat

     2821 caccggcacc aggcgcgacc gcccggagct ggccaggatg cttgaccacc tacgccctgg

     2881 cgacgttgtg acagtgacca ggctagaccg cctggcccgc agcacccgcg acctactgga

     2941 cattgccgag cgcatccagg aggccggcgc gggcctgcgt agcctggcag agccgtgggc

     3001 cgacaccacc acgccggccg gccgcatggt gttgaccgtg ttcgccggca ttgccgagtt

     3061 cgagcgttcc ctaatcatcg accgcacccg gagcgggcgc gaggccgcca aggcccgagg

     3121 cgtgaagttt ggcccccgcc ctaccctcac cccggcacag atcgcgcacg cccgcgagct

     3181 gatcgaccag gaaggccgca ccgtgaaaga ggcggctgca ctgcttggcg tgcatcgctc

     3241 gaccctgtac cgcgcacttg agcgcagcga ggaagtgacg cccaccgagg ccaggcggcg

     3301 cggtgccttc cgtgaggacg cattgaccga ggccgacgcc ctggcggccg ccgagaatga

     3361 acgccaagag gaacaagcat gaaaccgcac caggacggcc aggacgaacc gtttttcatt

     3421 accgaagaga tcgaggcgga gatgatcgcg gccgggtacg tgttcgagcc gcccgcgcac

     3481 gtctcaaccg tgcggctgca tgaaatcctg gccggtttgt ctgatgccaa gctggcggcc

     3541 tggccggcca gcttggccgc tgaagaaacc gagcgccgcc gtctaaaaag gtgatgtgta

     3601 tttgagtaaa acagcttgcg tcatgcggtc gctgcgtata tgatgcgatg agtaaataaa

     3661 caaatacgca aggggaacgc atgaaggtta tcgctgtact taaccagaaa ggcgggtcag

     3721 gcaagacgac catcgcaacc catctagccc gcgccctgca actcgccggg gccgatgttc

     3781 tgttagtcga ttccgatccc cagggcagtg cccgcgattg ggcggccgtg cgggaagatc

     3841 aaccgctaac cgttgtcggc atcgaccgcc cgacgattga ccgcgacgtg aaggccatcg

     3901 gccggcgcga cttcgtagtg atcgacggag cgccccaggc ggcggacttg gctgtgtccg

     3961 cgatcaaggc agccgacttc gtgctgattc cggtgcagcc aagcccttac gacatatggg

     4021 ccaccgccga cctggtggag ctggttaagc agcgcattga ggtcacggat ggaaggctac

     4081 aagcggcctt tgtcgtgtcg cgggcgatca aaggcacgcg catcggcggt gaggttgccg

     4141 aggcgctggc cgggtacgag ctgcccattc ttgagtcccg tatcacgcag cgcgtgagct

     4201 acccaggcac tgccgccgcc ggcacaaccg ttcttgaatc agaacccgag ggcgacgctg

     4261 cccgcgaggt ccaggcgctg gccgctgaaa ttaaatcaaa actcatttga gttaatgagg

     4321 taaagagaaa atgagcaaaa gcacaaacac gctaagtgcc ggccgtccga gcgcacgcag

     4381 cagcaaggct gcaacgttgg ccagcctggc agacacgcca gccatgaagc gggtcaactt

     4441 tcagttgccg gcggaggatc acaccaagct gaagatgtac gcggtacgcc aaggcaagac

     4501 cattaccgag ctgctatctg aatacatcgc gcagctacca gagtaaatga gcaaatgaat

     4561 aaatgagtag atgaatttta gcggctaaag gaggcggcat ggaaaatcaa gaacaaccag

     4621 gcaccgacgc cgtggaatgc cccatgtgtg gaggaacggg cggttggcca ggcgtaagcg

     4681 gctgggttgt ctgccggccc tgcaatggca ctggaacccc caagcccgag gaatcggcgt

     4741 gacggtcgca aaccatccgg cccggtacaa atcggcgcgg cgctgggtga tgacctggtg

     4801 gagaagttga aggccgcgca ggccgcccag cggcaacgca tcgaggcaga agcacgcccc

     4861 ggtgaatcgt ggcaagcggc cgctgatcga atccgcaaag aatcccggca accgccggca

     4921 gccggtgcgc cgtcgattag gaagccgccc aagggcgacg agcaaccaga ttttttcgtt

     4981 ccgatgctct atgacgtggg cacccgcgat agtcgcagca tcatggacgt ggccgttttc

     5041 cgtctgtcga agcgtgaccg acgagctggc gaggtgatcc gctacgagct tccagacggg

     5101 cacgtagagg tttccgcagg gccggccggc atggccagtg tgtgggatta cgacctggta

     5161 ctgatggcgg tttcccatct aaccgaatcc atgaaccgat accgggaagg gaagggagac

     5221 aagcccggcc gcgtgttccg tccacacgtt gcggacgtac tcaagttctg ccggcgagcc

     5281 gatggcggaa agcagaaaga cgacctggta gaaacctgca ttcggttaaa caccacgcac

     5341 gttgccatgc agcgtacgaa gaaggccaag aacggccgcc tggtgacggt atccgagggt

     5401 gaagccttga ttagccgcta caagatcgta aagagcgaaa ccgggcggcc ggagtacatc

     5461 gagatcgagc tagctgattg gatgtaccgc gagatcacag aaggcaagaa cccggacgtg

     5521 ctgacggttc accccgatta ctttttgatc gatcccggca tcggccgttt tctctaccgc

     5581 ctggcacgcc gcgccgcagg caaggcagaa gccagatggt tgttcaagac gatctacgaa

     5641 cgcagtggca gcgccggaga gttcaagaag ttctgtttca ccgtgcgcaa gctgatcggg

     5701 tcaaatgacc tgccggagta cgatttgaag gaggaggcgg ggcaggctgg cccgatccta

     5761 gtcatgcgct accgcaacct gatcgagggc gaagcatccg ccggttccta atgtacggag

     5821 cagatgctag ggcaaattgc cctagcaggg gaaaaaggtc gaaaaggtct ctttcctgtg

     5881 gatagcacgt acattgggaa cccaaagccg tacattggga accggaaccc gtacattggg

     5941 aacccaaagc cgtacattgg gaaccggtca cacatgtaag tgactgatat aaaagagaaa

     6001 aaaggcgatt tttccgccta aaactcttta aaacttatta aaactcttaa aacccgcctg

     6061 gcctgtgcat aactgtctgg ccagcgcaca gccgaagagc tgcaaaaagc gcctaccctt

     6121 cggtcgctgc gctccctacg ccccgccgct tcgcgtcggc ctatcgcggc cgctggccgc

     6181 tcaaaaatgg ctggcctacg gccaggcaat ctaccagggc gcggacaagc cgcgccgtcg

     6241 ccactcgacc gccggcgccc acatcaaggc accctgcctc gcgcgtttcg gtgatgacgg

     6301 tgaaaacctc tgacacatgc agctcccgga gacggtcaca gcttgtctgt aagcggatgc

     6361 cgggagcaga caagcccgtc agggcgcgtc agcgggtgtt ggcgggtgtc ggggcgcagc

     6421 catgacccag tcacgtagcg atagcggagt gtatactggc ttaactatgc ggcatcagag

     6481 cagattgtac tgagagtgca ccatatgcgg tgtgaaatac cgcacagatg cgtaaggaga

     6541 aaataccgca tcaggcgctc ttccgcttcc tcgctcactg actcgctgcg ctcggtcgtt

     6601 cggctgcggc gagcggtatc agctcactca aaggcggtaa tacggttatc cacagaatca

     6661 ggggataacg caggaaagaa catgtgagca aaaggccagc aaaaggccag gaaccgtaaa

     6721 aaggccgcgt tgctggcgtt tttccatagg ctccgccccc ctgacgagca tcacaaaaat

     6781 cgacgctcaa gtcagaggtg gcgaaacccg acaggactat aaagatacca ggcgtttccc

     6841 cctggaagct ccctcgtgcg ctctcctgtt ccgaccctgc cgcttaccgg atacctgtcc

     6901 gcctttctcc cttcgggaag cgtggcgctt tctcatagct cacgctgtag gtatctcagt

     6961 tcggtgtagg tcgttcgctc caagctgggc tgtgtgcacg aaccccccgt tcagcccgac

     7021 cgctgcgcct tatccggtaa ctatcgtctt gagtccaacc cggtaagaca cgacttatcg

     7081 ccactggcag cagccactgg taacaggatt agcagagcga ggtatgtagg cggtgctaca

     7141 gagttcttga agtggtggcc taactacggc tacactagaa ggacagtatt tggtatctgc

     7201 gctctgctga agccagttac cttcggaaaa agagttggta gctcttgatc cggcaaacaa

     7261 accaccgctg gtagcggtgg tttttttgtt tgcaagcagc agattacgcg cagaaaaaaa

     7321 ggatctcaag aagatccttt gatcttttct acggggtctg acgctcagtg gaacgaaaac

     7381 tcacgttaag ggattttggt catgcattct aggtactaaa acaattcatc cagtaaaata

     7441 taatatttta ttttctccca atcaggcttg atccccagta agtcaaaaaa tagctcgaca

     7501 tactgttctt ccccgatatc ctccctgatc gaccggacgc agaaggcaat gtcataccac

     7561 ttgtccgccc tgccgcttct cccaagatca ataaagccac ttactttgcc atctttcaca

     7621 aagatgttgc tgtctcccag gtcgccgtgg gaaaagacaa gttcctcttc gggcttttcc

     7681 gtctttaaaa aatcatacag ctcgcgcgga tctttaaatg gagtgtcttc ttcccagttt

     7741 tcgcaatcca catcggccag atcgttattc agtaagtaat ccaattcggc taagcggctg

     7801 tctaagctat tcgtataggg acaatccgat atgtcgatgg agtgaaagag cctgatgcac

     7861 tccgcataca gctcgataat cttttcaggg ctttgttcat cttcatactc ttccgagcaa

     7921 aggacgccat cggcctcact catgagcaga ttgctccagc catcatgccg ttcaaagtgc

     7981 aggacctttg gaacaggcag ctttccttcc agccatagca tcatgtcctt ttcccgttcc

     8041 acatcatagg tggtcccttt ataccggctg tccgtcattt ttaaatatag gttttcattt

     8101 tctcccacca gcttatatac cttagcagga gacattcctt ccgtatcttt tacgcagcgg

     8161 tatttttcga tcagtttttt caattccggt gatattctca ttttagccat ttattatttc

     8221 cttcctcttt tctacagtat ttaaagatac cccaagaagc taattataac aagacgaact

     8281 ccaattcact gttccttgca ttctaaaacc ttaaatacca gaaaacagct ttttcaaagt

     8341 tgttttcaaa gttggcgtat aacatagtat cgacggagcc gattttgaaa ccgcggtgat

     8401 cacaggcagc aacgctctgt catcgttaca atcaacatgc taccctccgc gagatcatcc

     8461 gtgtttcaaa cccggcagct tagttgccgt tcttccgaat agcatcggta acatgagcaa

     8521 agtctgccgc cttacaacgg ctctcccgct gacgccgtcc cggactgatg ggctgcctgt

     8581 atcgagtggt gattttgtgc cgagctgccg gtcggggagc tgttggctgg ctggtggcag

     8641 gatatattgt ggtgtaaaca aattgacgct tagacaactt aataacacat tgcggacgtt

     8701 tttaatgtac tgaattaacg ccgaattaat tcgggggatc tggattttag tactggattt

     8761 tggttttagg aattagaaat tttattgata gaagtatttt acaaatacaa atacatacta

     8821 agggtttctt atatgctcaa cacatgagcg aaaccctata ggaaccctaa ttcccttatc

     8881 tgggaactac tcacacatta ttatggagaa actcgagtca aatctcggtg acgggcagga

     8941 ccggacgggg cggtaccggc aggctgaagt ccagctgcca gaaacccacg tcatgccagt

     9001 tcccgtgctt gaagccggcc gcccgcagca tgccgcgggg ggcatatccg agcgcctcgt

     9061 gcatgcgcac gctcgggtcg ttgggcagcc cgatgacagc gaccacgctc ttgaagccct

     9121 gtgcctccag ggacttcagc aggtgggtgt agagcgtgga gcccagtccc gtccgctggt

     9181 ggcgggggga gacgtacacg gtcgactcgg ccgtccagtc gtaggcgttg cgtgccttcc

     9241 aggggcccgc gtaggcgatg ccggcgacct cgccgtccac ctcggcgacg agccagggat

     9301 agcgctcccg cagacggacg aggtcgtccg tccactcctg cggttcctgc ggctcggtac

     9361 ggaagttgac cgtgcttgtc tcgatgtagt ggttgacgat ggtgcagacc gccggcatgt

     9421 ccgcctcggt ggcacggcgg atgtcggccg ggcgtcgttc tgggctcatg gtagactcga

     9481 gagagataga tttgtagaga gagactggtg atttcagcgt gtcctctcca aatgaaatga

     9541 acttccttat atagaggaag gtcttgcgaa ggatagtggg attgtgcgtc atcccttacg

     9601 tcagtggaga tatcacatca atccacttgc tttgaagacg tggttggaac gtcttctttt

     9661 tccacgatgc tcctcgtggg tgggggtcca tctttgggac cactgtcggc agaggcatct

     9721 tgaacgatag cctttccttt atcgcaatga tggcatttgt aggtgccacc ttccttttct

     9781 actgtccttt tgatgaagtg acagatagct gggcaatgga atccgaggag gtttcccgat

     9841 attacccttt gttgaaaagt ctcaatagcc ctttggtctt ctgagactgt atctttgata

     9901 ttcttggagt agacgagagt gtcgtgctcc accatgttat cacatcaatc cacttgcttt

     9961 gaagacgtgg ttggaacgtc ttctttttcc acgatgctcc tcgtgggtgg gggtccatct

    10021 ttgggaccac tgtcggcaga ggcatcttga acgatagcct ttcctttatc gcaatgatgg

    10081 catttgtagg tgccaccttc cttttctact gtccttttga tgaagtgaca gatagctggg

    10141 caatggaatc cgaggaggtt tcccgatatt accctttgtt gaaaagtctc aatagccctt

    10201 tggtcttctg agactgtatc tttgatattc ttggagtaga cgagagtgtc gtgctccacc

    10261 atgttggcaa gctgctctag ccaatacgca aaccgcctct ccccgcgcgt tggccgattc

    10321 attaatgcag ctggcacgac aggtttcccg actggaaagc gggcagtgag cgcaacgcaa

    10381 ttaatgtgag ttagctcact cattaggcac cccaggcttt acactttatg cttccggctc

    10441 gtatgttgtg tggaattgtg agcggataac aatttcacac aggaaacagc tatgaccatg

    10501 attacgaatt cgagctcggt acccggggat cctctagagt cgacctgcag gcatgcaagc

    10561 ttggcactgg ccgtcgtttt acaacgtcgt gactgggaaa accctggcgt tacccaactt

    10621 aatcgccttg cagcacatcc ccctttcgcc agctggcgta atagcgaaga ggcccgcacc

    10681 gatcgccctt cccaacagtt gcgcagcctg aatggcgaat gctagagcag cttgagcttg

    10741 gatcagattg tcgtttcccg ccttcagttt agcttcatgg agtcaaagat tcaaatagag

    10801 gacctaacag aactcgccgt aaagactggc gaacagttca tacagagtct cttacgactc

    10861 aatgacaaga agaaaatctt cgtcaacatg gtggagcacg acacacttgt ctactccaaa

    10921 aatatcaaag atacagtctc agaagaccaa agggcaattg agacttttca acaaagggta

    10981 atatccggaa acctcctcgg attccattgc ccagctatct gtcactttat tgtgaagata

    11041 gtggaaaagg aaggtggctc ctacaaatgc catcattgcg ataaaggaaa ggccatcgtt

    11101 gaagatgcct ctgccgacag tggtcccaaa gatggacccc cacccacgag gagcatcgtg

    11161 gaaaaagaag acgttccaac cacgtcttca aagcaagtgg attgatgtga tatctccact

    11221 gacgtaaggg atgacgcaca atcccactat ccttcgcaag acccttcctc tatataagga

    11281 agttcatttc atttggagag aacacggggg actcttgac

//

 

Caution:
Product is for research use only!

 

Search name

pCAMBIA3301,Plasmid pCAMBIA3301,pCAMBIA3301 vector

No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart