pCDH- CMV- MCS- EF1- copGFP

$216.00

  • Model: PVT2334
  • 50 Units in Stock
Ask a question


Add to Cart:

pCDH-CMV-MCS-EF1-copGFP

 

PVT2334       2ug

 

pCDH-CMV-MCS-EF1-copGFP Information

Promoter: EF-1 alpha core, CMV
Replicator: pUC ori, SV40 ori
Terminator: SV40 poly (A) signal
Plasmid classification: virus series, lentivirus cloning vector
Plasmid size: 7544bp
Prokaryotic resistance: Amp
Cloned strain: Stbl3
Culture conditions: 37 centigrade, aerobic LB
Expression host: mammalian cells
Induction mode: no induction, instantaneous expression
5'sequencing primers: CMV-F:CGCAAATGGGCGGTAGGCGTG
3'sequencing primers: primers designed according to sequence
Use:Lentiviral

 

pCDH-CMV-MCS-EF1-copGFP Description

pCDH-CMV-MCS-EF1-copGFP is a lentivirus expression plasmid. The puromycin-resistance gene (puro) was cloned into pCDH-EF1-MCS-T2A-copGFP (A) and pCDH-MCS-T2A-copGFP-MSCV (B); and the copGFP gene (cG) was cloned into pCDH-EF1-MCS-T2A-Puro (C) and pCDH-MCS-T2A-Puro-MSCV (D). The resulting dual reporter constructs were packaged into pseudoviral particles followed by transduction into HT1080 cells. All constructs were also puromycin resistant (data not shown)

pCDH-CMV-MCS-EF1-copGFP-polyclonal-site

 

 

pCDH-CMV-MCS-EF1-copGFP Sequence

LOCUS       Exported                7546 bp ds-DNA     circular SYN 20-SEP-2018

DEFINITION  synthetic circular DNA

KEYWORDS    pCDH-CMV-MCS-EF1-copGFP

SOURCE      synthetic DNA construct

  ORGANISM  synthetic DNA construct

REFERENCE   1  (bases 1 to 7546)

FEATURES             Location/Qualifiers

     source          1..7546

                     /organism="synthetic DNA construct"

                     /mol_type="other DNA"

     LTR             234..414

                     /note="5' LTR (truncated)"

                     /note="truncated 5' long terminal repeat (LTR) from HIV-1"

     misc_feature    458..583

                     /note="HIV-1 Psi"

                     /note="packaging signal of human immunodeficiency virus 

                     type 1"

     misc_feature    1076..1309

                     /note="RRE"

                     /note="The Rev response element (RRE) of HIV-1 allows for 

                     Rev-dependent mRNA export from the nucleus to the 

                     cytoplasm."

     misc_feature    1798..1915

                     /note="cPPT/CTS"

                     /note="central polypurine tract and central termination 

                     sequence of HIV-1"

     promoter        2005..2208

                     /note="CMV promoter"

                     /note="human cytomegalovirus (CMV) immediate early 

                     promoter"

     promoter        2349..2560

                     /note="EF-1-alpha core promoter"

                     /note="core promoter for human elongation factor 

                     EF-1-alpha"

     LTR             2573..2841

                     /note="5' LTR (truncated)"

                     /note="truncated 5' long terminal repeat (LTR) from human 

                     T-cell leukemia virus (HTLV) type 1"

     regulatory      2870..2879

                     /regulatory_class="other"

                     /note="Kozak sequence"

                     /note="vertebrate consensus sequence for strong initiation 

                     of translation (Kozak, 1987)"

     CDS             2900..3562

                     /codon_start=1

                     /product="green fluorescent protein 2 from Pontellina 

                     plumata, also known as ppluGFP2 (Shagin et al., 2004)"

                     /note="CopGFP"

                     /translation="PAMEIECRITGTLNGVEFELVGGGEGTPKQGRMTNKMKSTKGALT

                     FSPYLLSHVMGYGFYHFGTYPSGYENPFLHAINNGGYTNTRIEKYEDGGVLHVSFSYRY

                     EAGRVIGDFKVVGTGFPEDSVIFTDKIIRSNATVEHLHPMGDNVLVGSFARTFSLRDGG

                     YYSFVVDSHMHFKSAIHPSILQNGGPMFAFRRVEELHSNTELGIVEYQHAFKTPIAFA"

     misc_feature    3641..4229

                     /note="WPRE"

                     /note="woodchuck hepatitis virus posttranscriptional 

                     regulatory element"

     LTR             4303..4536

                     /note="3' LTR (Delta-U3)"

                     /note="self-inactivating 3' long terminal repeat (LTR) from

                     HIV-1"

     polyA_signal    4608..4729

                     /note="SV40 poly(A) signal"

                     /note="SV40 polyadenylation signal"

     rep_origin      4748..4883

                     /note="SV40 ori"

                     /note="SV40 origin of replication"

     rep_origin      complement(5323..5911)

                     /direction=LEFT

                     /note="ori"

                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 

                     replication"

     CDS             complement(6082..6942)

                     /codon_start=1

                     /gene="bla"

                     /product="beta-lactamase"

                     /note="AmpR"

                     /note="confers resistance to ampicillin, carbenicillin, and

                     related antibiotics"

                     /translation="[TEM beta-lactamase fragment, 45 aa]

                     ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVEYS

                     [TEM beta-lactamase fragment, 59 aa]

                     EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA

                     [TEM beta-lactamase fragment, 59 aa]

                     LIKHW"

     promoter        complement(6943..7047)

                     /gene="bla"

                     /note="AmpR promoter"

ORIGIN

        1 acgcgtgtag tcttatgcaa tactcttgta gtcttgcaac atggtaacga tgagttagca

       61 acatgcctta caaggagaga aaaagcaccg tgcatgccga ttggtggaag taaggtggta

      121 cgatcgtgcc ttattaggaa ggcaacagac gggtctgaca tggattggac gaaccactga

      181 attgccgcat tgcagagata ttgtatttaa gtgcctagct cgatacaata aacgggtctc

      241 tctggttaga ccagatctga gcctgggagc tctctggcta actagggaac ccactgctta

      301 agcctcaata aagcttgcct tgagtgcttc aagtagtgtg tgcccgtctg ttgtgtgact

      361 ctggtaacta gagatccctc agaccctttt agtcagtgtg gaaaatctct agcagtggcg

      421 cccgaacagg gacctgaaag cgaaagggaa accagagctc tctcgacgca ggactcggct

      481 tgctgaagcg cgcacggcaa gaggcgaggg gcggcgactg gtgagtacgc caaaaatttt

      541 gactagcgga ggctagaagg agagagatgg gtgcgagagc gtcagtatta agcgggggag

      601 aattagatcg cgatgggaaa aaattcggtt aaggccaggg ggaaagaaaa aatataaatt

      661 aaaacatata gtatgggcaa gcagggagct agaacgattc gcagttaatc ctggcctgtt

      721 agaaacatca gaaggctgta gacaaatact gggacagcta caaccatccc ttcagacagg

      781 atcagaagaa cttagatcat tatataatac agtagcaacc ctctattgtg tgcatcaaag

      841 gatagagata aaagacacca aggaagcttt agacaagata gaggaagagc aaaacaaaag

      901 taagaccacc gcacagcaag cggccactga tcttcagacc tggaggagga gatatgaggg

      961 acaattggag aagtgaatta tataaatata aagtagtaaa aattgaacca ttaggagtag

     1021 cacccaccaa ggcaaagaga agagtggtgc agagagaaaa aagagcagtg ggaataggag

     1081 ctttgttcct tgggttcttg ggagcagcag gaagcactat gggcgcagcc tcaatgacgc

     1141 tgacggtaca ggccagacaa ttattgtctg gtatagtgca gcagcagaac aatttgctga

     1201 gggctattga ggcgcaacag catctgttgc aactcacagt ctggggcatc aagcagctcc

     1261 aggcaagaat cctggctgtg gaaagatacc taaaggatca acagctcctg gggatttggg

     1321 gttgctctgg aaaactcatt tgcaccactg ctgtgccttg gaatgctagt tggagtaata

     1381 aatctctgga acagattgga atcacacgac ctggatggag tgggacagag aaattaacaa

     1441 ttacacaagc ttaatacact ccttaattga agaatcgcaa aaccagcaag aaaagaatga

     1501 acaagaatta ttggaattag ataaatgggc aagtttgtgg aattggttta acataacaaa

     1561 ttggctgtgg tatataaaat tattcataat gatagtagga ggcttggtag gtttaagaat

     1621 agtttttgct gtactttcta tagtgaatag agttaggcag ggatattcac cattatcgtt

     1681 tcagacccac ctcccaaccc cgaggggacc cgacaggccc gaaggaatag aagaagaagg

     1741 tggagagaga gacagagaca gatccattcg attagtgaac ggatctcgac ggttaacttt

     1801 taaaagaaaa ggggggattg gggggtacag tgcaggggaa agaatagtag acataatagc

     1861 aacagacata caaactaaag aattacaaaa acaaattaca aaaattcaaa attttatcga

     1921 tactagtatt atgcccagta catgacctta tgggactttc ctacttggca gtacatctac

     1981 gtattagtca tcgctattac catggtgatg cggttttggc agtacatcaa tgggcgtgga

     2041 tagcggtttg actcacgggg atttccaagt ctccacccca ttgacgtcaa tgggagtttg

     2101 ttttggcacc aaaatcaacg ggactttcca aaatgtcgta acaactccgc cccattgacg

     2161 caaatgggcg gtaggcgtgt acggtgggag gtctatataa gcagagctcg tttagtgaac

     2221 cgtcagatcg cctggagacg ccatccacgc tgttttgacc tccatagaag attctagagc

     2281 tagcgaattc gaatttaaat cggatccgcg gccgcgaagg atctgcgatc gctccggtgc

     2341 ccgtcagtgg gcagagcgca catcgcccac agtccccgag aagttggggg gaggggtcgg

     2401 caattgaacg ggtgcctaga gaaggtggcg cggggtaaac tgggaaagtg atgtcgtgta

     2461 ctggctccgc ctttttcccg agggtggggg agaaccgtat ataagtgcag tagtcgccgt

     2521 gaacgttctt tttcgcaacg ggtttgccgc cagaacacag ctgaagcttc gaggggctcg

     2581 catctctcct tcacgcgccc gccgccctac ctgaggccgc catccacgcc ggttgagtcg

     2641 cgttctgccg cctcccgcct gtggtgcctc ctgaactgcg tccgccgtct aggtaagttt

     2701 aaagctcagg tcgagaccgg gcctttgtcc ggcgctccct tggagcctac ctagactcag

     2761 ccggctctcc acgctttgcc tgaccctgct tgctcaactc tacgtctttg tttcgttttc

     2821 tgttctgcgc cgttacagat ccaagctgtg accggcgcct acgctagacg ccaccatgga

     2881 gagcgacgag agcggcctgc ccgccatgga gatcgagtgc cgcatcaccg gcaccctgaa

     2941 cggcgtggag ttcgagctgg tgggcggcgg agagggcacc cccaagcagg gccgcatgac

     3001 caacaagatg aagagcacca aaggcgccct gaccttcagc ccctacctgc tgagccacgt

     3061 gatgggctac ggcttctacc acttcggcac ctaccccagc ggctacgaga accccttcct

     3121 gcacgccatc aacaacggcg gctacaccaa cacccgcatc gagaagtacg aggacggcgg

     3181 cgtgctgcac gtgagcttca gctaccgcta cgaggccggc cgcgtgatcg gcgacttcaa

     3241 ggtggtgggc accggcttcc ccgaggacag cgtgatcttc accgacaaga tcatccgcag

     3301 caacgccacc gtggagcacc tgcaccccat gggcgataac gtgctggtgg gcagcttcgc

     3361 ccgcaccttc agcctgcgcg acggcggcta ctacagcttc gtggtggaca gccacatgca

     3421 cttcaagagc gccatccacc ccagcatcct gcagaacggg ggccccatgt tcgccttccg

     3481 ccgcgtggag gagctgcaca gcaacaccga gctgggcatc gtggagtacc agcacgcctt

     3541 caagaccccc atcgccttcg ccagatcccg cgctcagtcg tccaattctg ccgtggacgg

     3601 caccgccgga cccggctcca ccggatctcg ctaagtcgac aatcaacctc tggattacaa

     3661 aatttgtgaa agattgactg gtattcttaa ctatgttgct ccttttacgc tatgtggata

     3721 cgctgcttta atgcctttgt atcatgctat tgcttcccgt atggctttca ttttctcctc

     3781 cttgtataaa tcctggttgc tgtctcttta tgaggagttg tggcccgttg tcaggcaacg

     3841 tggcgtggtg tgcactgtgt ttgctgacgc aacccccact ggttggggca ttgccaccac

     3901 ctgtcagctc ctttccggga ctttcgcttt ccccctccct attgccacgg cggaactcat

     3961 cgccgcctgc cttgcccgct gctggacagg ggctcggctg ttgggcactg acaattccgt

     4021 ggtgttgtcg gggaaatcat cgtcctttcc ttggctgctc gcctgtgttg ccacctggat

     4081 tctgcgcggg acgtccttct gctacgtccc ttcggccctc aatccagcgg accttccttc

     4141 ccgcggcctg ctgccggctc tgcggcctct tccgcgtctt cgccttcgcc ctcagacgag

     4201 tcggatctcc ctttgggccg cctccccgcc tggtaccttt aagaccaatg acttacaagg

     4261 cagctgtaga tcttagccac tttttaaaag aaaagggggg actggaaggg ctaattcact

     4321 cccaacgaaa ataagatctg ctttttgctt gtactgggtc tctctggtta gaccagatct

     4381 gagcctggga gctctctggc taactaggga acccactgct taagcctcaa taaagcttgc

     4441 cttgagtgct tcaagtagtg tgtgcccgtc tgttgtgtga ctctggtaac tagagatccc

     4501 tcagaccctt ttagtcagtg tggaaaatct ctagcagtag tagttcatgt catcttatta

     4561 ttcagtattt ataacttgca aagaaatgaa tatcagagag tgagaggaac ttgtttattg

     4621 cagcttataa tggttacaaa taaagcaata gcatcacaaa tttcacaaat aaagcatttt

     4681 tttcactgca ttctagttgt ggtttgtcca aactcatcaa tgtatcttat catgtctggc

     4741 tctagctatc ccgcccctaa ctccgcccag ttccgcccat tctccgcccc atggctgact

     4801 aatttttttt atttatgcag aggccgaggc cgcctcggcc tctgagctat tccagaagta

     4861 gtgaggaggc ttttttggag gcctagactt ttgcagagac ggcccaaatt cgtaatcatg

     4921 gtcatagctg tttcctgtgt gaaattgtta tccgctcaca attccacaca acatacgagc

     4981 cggaagcata aagtgtaaag cctggggtgc ctaatgagtg agctaactca cattaattgc

     5041 gttgcgctca ctgcccgctt tccagtcggg aaacctgtcg tgccagctgc attaatgaat

     5101 cggccaacgc gcggggagag gcggtttgcg tattgggcgc tcttccgctt cctcgctcac

     5161 tgactcgctg cgctcggtcg ttcggctgcg gcgagcggta tcagctcact caaaggcggt

     5221 aatacggtta tccacagaat caggggataa cgcaggaaag aacatgtgag caaaaggcca

     5281 gcaaaaggcc aggaaccgta aaaaggccgc gttgctggcg tttttccata ggctccgccc

     5341 ccctgacgag catcacaaaa atcgacgctc aagtcagagg tggcgaaacc cgacaggact

     5401 ataaagatac caggcgtttc cccctggaag ctccctcgtg cgctctcctg ttccgaccct

     5461 gccgcttacc ggatacctgt ccgcctttct cccttcggga agcgtggcgc tttctcatag

     5521 ctcacgctgt aggtatctca gttcggtgta ggtcgttcgc tccaagctgg gctgtgtgca

     5581 cgaacccccc gttcagcccg accgctgcgc cttatccggt aactatcgtc ttgagtccaa

     5641 cccggtaaga cacgacttat cgccactggc agcagccact ggtaacagga ttagcagagc

     5701 gaggtatgta ggcggtgcta cagagttctt gaagtggtgg cctaactacg gctacactag

     5761 aaggacagta tttggtatct gcgctctgct gaagccagtt accttcggaa aaagagttgg

     5821 tagctcttga tccggcaaac aaaccaccgc tggtagcggt ggtttttttg tttgcaagca

     5881 gcagattacg cgcagaaaaa aaggatctca agaagatcct ttgatctttt ctacggggtc

     5941 tgacgctcag tggaacgaaa actcacgtta agggattttg gtcatgagat tatcaaaaag

     6001 gatcttcacc tagatccttt taaattaaaa atgaagtttt aaatcaatct aaagtatata

     6061 tgagtaaact tggtctgaca gttaccaatg cttaatcagt gaggcaccta tctcagcgat

     6121 ctgtctattt cgttcatcca tagttgcctg actccccgtc gtgtagataa ctacgatacg

     6181 ggagggctta ccatctggcc ccagtgctgc aatgataccg cgagacccac gctcaccggc

     6241 tccagattta tcagcaataa accagccagc cggaagggcc gagcgcagaa gtggtcctgc

     6301 aactttatcc gcctccatcc agtctattaa ttgttgccgg gaagctagag taagtagttc

     6361 gccagttaat agtttgcgca acgttgttgc cattgctaca ggcatcgtgg tgtcacgctc

     6421 gtcgtttggt atggcttcat tcagctccgg ttcccaacga tcaaggcgag ttacatgatc

     6481 ccccatgttg tgcaaaaaag cggttagctc cttcggtcct ccgatcgttg tcagaagtaa

     6541 gttggccgca gtgttatcac tcatggttat ggcagcactg cataattctc ttactgtcat

     6601 gccatccgta agatgctttt ctgtgactgg tgagtactca accaagtcat tctgagaata

     6661 gtgtatgcgg cgaccgagtt gctcttgccc ggcgtcaata cgggataata ccgcgccaca

     6721 tagcagaact ttaaaagtgc tcatcattgg aaaacgttct tcggggcgaa aactctcaag

     6781 gatcttaccg ctgttgagat ccagttcgat gtaacccact cgtgcaccca actgatcttc

     6841 agcatctttt actttcacca gcgtttctgg gtgagcaaaa acaggaaggc aaaatgccgc

     6901 aaaaaaggga ataagggcga cacggaaatg ttgaatactc atactcttcc tttttcaata

     6961 ttattgaagc atttatcagg gttattgtct catgagcgga tacatatttg aatgtattta

     7021 gaaaaataaa caaatagggg ttccgcgcac atttccccga aaagtgccac ctgacgtcta

     7081 agaaaccatt attatcatga cattaaccta taaaaatagg cgtatcacga ggccctttcg

     7141 tctcgcgcgt ttcggtgatg acggtgaaaa cctctgacac atgcagctcc cggagacggt

     7201 cacagcttgt ctgtaagcgg atgccgggag cagacaagcc cgtcagggcg cgtcagcggg

     7261 tgttggcggg tgtcggggct ggcttaacta tgcggcatca gagcagattg tactgagagt

     7321 gcaccatatg cggtgtgaaa taccgcacag atgcgtaagg agaaaatacc gcatcaggcg

     7381 ccattcgcca ttcaggctgc gcaactgttg ggaagggcga tcggtgcggg cctcttcgct

     7441 attacgccag ctggcgaaag ggggatgtgc tgcaaggcga ttaagttggg taacgccagg

     7501 gttttcccag tcacgacgtt gtaaaacgac ggccagtgcc aagctg

//

 

Caution:
Product is for research use only!

 

 

Search name

pCDH-CMV-MCS-EF1-copGFP,Plasmid pCDH-CMV-MCS-EF1-copGFP,pCDH-CMV-MCS-EF1-copGFP vector

No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart