pCDH- EF1- MCS- T2A- copGFP

$216.00

  • Model: PVT2336
  • 50 Units in Stock
Ask a question


Add to Cart:

pCDH-EF1-MCS-T2A-copGFP

PVT2336  2ug

 

pCDH-EF1-MCS-T2A-copGFP Information

Promoter: EF-1 alpha core

Replicator: pUC ori, SV40 ori

Terminator: SV40 poly (A) signal

Plasmid classification: virus series, lentivirus cloning vector

Plasmid size: 7266bp

Prokaryotic resistance: Amp

Cloned strain: Stbl3

Culture conditions: 37 centigrade, aerobic LB

Expression host: mammalian cells

Induction mode: no induction, instantaneous expression

5'sequencing primers: primers designed according to sequence

3'sequencing primers: primers designed according to sequence

Use:Lentiviral

 

pCDH-EF1-MCS-T2A-copGFP Description

Stable overexpression with cDNA lentivectors Strong and ubiquitous expression of the gene of interestSingle or double expression cassette with choice of reporter geneTarget gene expressed from CMV, EF1, or MSCV promoter Choose from FIV- or HIV-based vectors Gene expression from constitutive promoters,The multiple cloning site (MCS) located downstream of an internal promoter allows convenient cloning of your gene of interest.

pCDH-EF1-MCS-T2A-copGFP-vector

 

 

pCDH-EF1-MCS-T2A-copGFP Sequence

LOCUS       Exported                7266 bp ds-DNA     circular SYN 05-AUG-2016

DEFINITION  synthetic circular DNA

ACCESSION   .

VERSION     .

KEYWORDS    pCDH-EF1-MCS-T2A-copGFP (CD521A-1)

SOURCE      synthetic DNA construct

  ORGANISM  synthetic DNA construct

REFERENCE   1  (bases 1 to 7266)

  AUTHORS   .

  TITLE     Direct Submission

  JOURNAL   Exported Thursday, September 8, 2016 from SnapGene Viewer 3.1.4

FEATURES             Location/Qualifiers

     source          1..7266

                     /organism="synthetic DNA construct"

                     /mol_type="other DNA"

     LTR             234..414

                     /note="5' LTR (truncated)"

                     /note="truncated 5' long terminal repeat (LTR) from HIV-1"

     misc_feature    458..583

                     /note="HIV-1 Psi"

                     /note="packaging signal of human immunodeficiency virus 

                     type 1"

     misc_feature    1076..1309

                     /note="RRE"

                     /note="The Rev response element (RRE) of HIV-1 allows for 

                     Rev-dependent mRNA export from the nucleus to the 

                     cytoplasm."

     misc_feature    1804..1921

                     /note="cPPT/CTS"

                     /note="central polypurine tract and central termination 

                     sequence of HIV-1"

     promoter        1966..2177

                     /note="EF-1-alpha core promoter"

                     /note="core promoter for human elongation factor 

                     EF-1-alpha"

     LTR             2190..2458

                     /note="5' LTR (truncated)"

                     /note="truncated 5' long terminal repeat (LTR) from human 

                     T-cell leukemia virus (HTLV) type 1"

     CDS             2524..2577

                     /codon_start=1

                     /product="2A peptide from Thosea asigna virus capsid 

                     protein"

                     /note="T2A"

                     /note="Eukaryotic ribosomes fail to insert a peptide bond 

                     between the Gly and Pro residues, yielding separate 

                     polypeptides."

                     /translation="EGRGSLLTCGDVEENPGP"

     CDS             2608..3270

                     /codon_start=1

                     /product="green fluorescent protein 2 from Pontellina 

                     plumata, also known as ppluGFP2 (Shagin et al., 2004)"

                     /note="CopGFP"

                     /translation="PAMEIECRITGTLNGVEFELVGGGEGTPKQGRMTNKMKSTKGALT

                     FSPYLLSHVMGYGFYHFGTYPSGYENPFLHAINNGGYTNTRIEKYEDGGVLHVSFSYRY

                     EAGRVIGDFKVVGTGFPEDSVIFTDKIIRSNATVEHLHPMGDNVLVGSFARTFSLRDGG

                     YYSFVVDSHMHFKSAIHPSILQNGGPMFAFRRVEELHSNTELGIVEYQHAFKTPIAFA"

     misc_feature    3361..3949

                     /note="WPRE"

                     /note="woodchuck hepatitis virus posttranscriptional 

                     regulatory element"

     CDS             complement(3832..3843)

                     /codon_start=1

                     /product="Factor Xa recognition and cleavage site"

                     /note="Factor Xa site"

                     /translation="IEGR"

     LTR             4023..4256

                     /note="3' LTR (Delta-U3)"

                     /note="self-inactivating 3' long terminal repeat (LTR) from

                     HIV-1"

     polyA_signal    4328..4449

                     /note="SV40 poly(A) signal"

                     /note="SV40 polyadenylation signal"

     rep_origin      4468..4603

                     /note="SV40 ori"

                     /note="SV40 origin of replication"

     primer_bind     complement(4641..4657)

                     /note="M13 rev"

                     /note="common sequencing primer, one of multiple similar 

                     variants"

     protein_bind    4665..4681

                     /bound_moiety="lac repressor encoded by lacI"

                     /note="lac operator"

                     /note="The lac repressor binds to the lac operator to 

                     inhibit transcription in E. coli. This inhibition can be 

                     relieved by adding lactose or 

                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."

     promoter        complement(4689..4719)

                     /note="lac promoter"

                     /note="promoter for the E. coli lac operon"

     protein_bind    4734..4755

                     /bound_moiety="E. coli catabolite activator protein"

                     /note="CAP binding site"

                     /note="CAP binding activates transcription in the presence 

                     of cAMP."

     rep_origin      complement(5043..5631)

                     /direction=LEFT

                     /note="ori"

                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 

                     replication"

     CDS             complement(5802..6662)

                     /codon_start=1

                     /gene="bla"

                     /product="beta-lactamase"

                     /note="AmpR"

                     /note="confers resistance to ampicillin, carbenicillin, and

                     related antibiotics"

                     /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI

                     ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVEYS

                     PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW

                     EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA

                     LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS

                     LIKHW"

     promoter        complement(6663..6767)

                     /gene="bla"

                     /note="AmpR promoter"

     primer_bind     7241..7257

                     /note="M13 fwd"

                     /note="common sequencing primer, one of multiple similar 

                     variants"

ORIGIN

        1 acgcgtgtag tcttatgcaa tactcttgta gtcttgcaac atggtaacga tgagttagca

       61 acatgcctta caaggagaga aaaagcaccg tgcatgccga ttggtggaag taaggtggta

      121 cgatcgtgcc ttattaggaa ggcaacagac gggtctgaca tggattggac gaaccactga

      181 attgccgcat tgcagagata ttgtatttaa gtgcctagct cgatacaata aacgggtctc

      241 tctggttaga ccagatctga gcctgggagc tctctggcta actagggaac ccactgctta

      301 agcctcaata aagcttgcct tgagtgcttc aagtagtgtg tgcccgtctg ttgtgtgact

      361 ctggtaacta gagatccctc agaccctttt agtcagtgtg gaaaatctct agcagtggcg

      421 cccgaacagg gacctgaaag cgaaagggaa accagagctc tctcgacgca ggactcggct

      481 tgctgaagcg cgcacggcaa gaggcgaggg gcggcgactg gtgagtacgc caaaaatttt

      541 gactagcgga ggctagaagg agagagatgg gtgcgagagc gtcagtatta agcgggggag

      601 aattagatcg cgatgggaaa aaattcggtt aaggccaggg ggaaagaaaa aatataaatt

      661 aaaacatata gtatgggcaa gcagggagct agaacgattc gcagttaatc ctggcctgtt

      721 agaaacatca gaaggctgta gacaaatact gggacagcta caaccatccc ttcagacagg

      781 atcagaagaa cttagatcat tatataatac agtagcaacc ctctattgtg tgcatcaaag

      841 gatagagata aaagacacca aggaagcttt agacaagata gaggaagagc aaaacaaaag

      901 taagaccacc gcacagcaag cggccactga tcttcagacc tggaggagga gatatgaggg

      961 acaattggag aagtgaatta tataaatata aagtagtaaa aattgaacca ttaggagtag

     1021 cacccaccaa ggcaaagaga agagtggtgc agagagaaaa aagagcagtg ggaataggag

     1081 ctttgttcct tgggttcttg ggagcagcag gaagcactat gggcgcagcc tcaatgacgc

     1141 tgacggtaca ggccagacaa ttattgtctg gtatagtgca gcagcagaac aatttgctga

     1201 gggctattga ggcgcaacag catctgttgc aactcacagt ctggggcatc aagcagctcc

     1261 aggcaagaat cctggctgtg gaaagatacc taaaggatca acagctcctg gggatttggg

     1321 gttgctctgg aaaactcatt tgcaccactg ctgtgccttg gaatgctagt tggagtaata

     1381 aatctctgga acagattgga atcacacgac ctggatggag tgggacagag aaattaacaa

     1441 ttacacaagc ttaatacact ccttaattga agaatcgcaa aaccagcaag aaaagaatga

     1501 acaagaatta ttggaattag ataaatgggc aagtttgtgg aattggttta acataacaaa

     1561 ttggctgtgg tatataaaat tattcataat gatagtagga ggcttggtag gtttaagaat

     1621 agtttttgct gtactttcta tagtgaatag agttaggcag ggatattcac cattatcgtt

     1681 tcagacccac ctcccaaccc cgaggggacc cgacaggccc gaaggaatag aagaagaagg

     1741 tggagagaga gacagagaca gatccattcg attagtgaac ggatctcgac ggtatcggtt

     1801 aacttttaaa agaaaagggg ggattggggg gtacagtgca ggggaaagaa tagtagacat

     1861 aatagcaaca gacatacaaa ctaaagaatt acaaaaacaa attacaaaaa ttcaaaattt

     1921 tatcgatact agtaaggatc tgcgatcgct ccggtgcccg tcagtgggca gagcgcacat

     1981 cgcccacagt ccccgagaag ttggggggag gggtcggcaa ttgaacgggt gcctagagaa

     2041 ggtggcgcgg ggtaaactgg gaaagtgatg tcgtgtactg gctccgcctt tttcccgagg

     2101 gtgggggaga accgtatata agtgcagtag tcgccgtgaa cgttcttttt cgcaacgggt

     2161 ttgccgccag aacacagctg aagcttcgag gggctcgcat ctctccttca cgcgcccgcc

     2221 gccctacctg aggccgccat ccacgccggt tgagtcgcgt tctgccgcct cccgcctgtg

     2281 gtgcctcctg aactgcgtcc gccgtctagg taagtttaaa gctcaggtcg agaccgggcc

     2341 tttgtccggc gctcccttgg agcctaccta gactcagccg gctctccacg ctttgcctga

     2401 ccctgcttgc tcaactctac gtctttgttt cgttttctgt tctgcgccgt tacagatcca

     2461 agctgtgacc ggcgcctact ctagagctag cgaattcgaa tttaaatcgg atccgcggcc

     2521 gctgagggca gaggaagtct tctaacatgc ggtgacgtgg aggagaatcc cggcccttcc

     2581 ggaatggaga gcgacgagag cggcctgccc gccatggaga tcgagtgccg catcaccggc

     2641 accctgaacg gcgtggagtt cgagctggtg ggcggcggag agggcacccc caagcagggc

     2701 cgcatgacca acaagatgaa gagcaccaaa ggcgccctga ccttcagccc ctacctgctg

     2761 agccacgtga tgggctacgg cttctaccac ttcggcacct accccagcgg ctacgagaac

     2821 cccttcctgc acgccatcaa caacggcggc tacaccaaca cccgcatcga gaagtacgag

     2881 gacggcggcg tgctgcacgt gagcttcagc taccgctacg aggccggccg cgtgatcggc

     2941 gacttcaagg tggtgggcac cggcttcccc gaggacagcg tgatcttcac cgacaagatc

     3001 atccgcagca acgccaccgt ggagcacctg caccccatgg gcgataacgt gctggtgggc

     3061 agcttcgccc gcaccttcag cctgcgcgac ggcggctact acagcttcgt ggtggacagc

     3121 cacatgcact tcaagagcgc catccacccc agcatcctgc agaacggggg ccccatgttc

     3181 gccttccgcc gcgtggagga gctgcacagc aacaccgagc tgggcatcgt ggagtaccag

     3241 cacgccttca agacccccat cgccttcgcc agatcccgcg ctcagtcgtc caattctgcc

     3301 gtggacggca ccgccggacc cggctccacc ggatctcgct agagctgaat ctaagtcgac

     3361 aatcaacctc tggattacaa aatttgtgaa agattgactg gtattcttaa ctatgttgct

     3421 ccttttacgc tatgtggata cgctgcttta atgcctttgt atcatgctat tgcttcccgt

     3481 atggctttca ttttctcctc cttgtataaa tcctggttgc tgtctcttta tgaggagttg

     3541 tggcccgttg tcaggcaacg tggcgtggtg tgcactgtgt ttgctgacgc aacccccact

     3601 ggttggggca ttgccaccac ctgtcagctc ctttccggga ctttcgcttt ccccctccct

     3661 attgccacgg cggaactcat cgccgcctgc cttgcccgct gctggacagg ggctcggctg

     3721 ttgggcactg acaattccgt ggtgttgtcg gggaaatcat cgtcctttcc ttggctgctc

     3781 gcctgtgttg ccacctggat tctgcgcggg acgtccttct gctacgtccc ttcggccctc

     3841 aatccagcgg accttccttc ccgcggcctg ctgccggctc tgcggcctct tccgcgtctt

     3901 cgccttcgcc ctcagacgag tcggatctcc ctttgggccg cctccccgcc tggtaccttt

     3961 aagaccaatg acttacaagg cagctgtaga tcttagccac tttttaaaag aaaagggggg

     4021 actggaaggg ctaattcact cccaacgaaa ataagatctg ctttttgctt gtactgggtc

     4081 tctctggtta gaccagatct gagcctggga gctctctggc taactaggga acccactgct

     4141 taagcctcaa taaagcttgc cttgagtgct tcaagtagtg tgtgcccgtc tgttgtgtga

     4201 ctctggtaac tagagatccc tcagaccctt ttagtcagtg tggaaaatct ctagcagtag

     4261 tagttcatgt catcttatta ttcagtattt ataacttgca aagaaatgaa tatcagagag

     4321 tgagaggaac ttgtttattg cagcttataa tggttacaaa taaagcaata gcatcacaaa

     4381 tttcacaaat aaagcatttt tttcactgca ttctagttgt ggtttgtcca aactcatcaa

     4441 tgtatcttat catgtctggc tctagctatc ccgcccctaa ctccgcccag ttccgcccat

     4501 tctccgcccc atggctgact aatttttttt atttatgcag aggccgaggc cgcctcggcc

     4561 tctgagctat tccagaagta gtgaggaggc ttttttggag gcctagactt ttgcagagac

     4621 ggcccaaatt cgtaatcatg gtcatagctg tttcctgtgt gaaattgtta tccgctcaca

     4681 attccacaca acatacgagc cggaagcata aagtgtaaag cctggggtgc ctaatgagtg

     4741 agctaactca cattaattgc gttgcgctca ctgcccgctt tccagtcggg aaacctgtcg

     4801 tgccagctgc attaatgaat cggccaacgc gcggggagag gcggtttgcg tattgggcgc

     4861 tcttccgctt cctcgctcac tgactcgctg cgctcggtcg ttcggctgcg gcgagcggta

     4921 tcagctcact caaaggcggt aatacggtta tccacagaat caggggataa cgcaggaaag

     4981 aacatgtgag caaaaggcca gcaaaaggcc aggaaccgta aaaaggccgc gttgctggcg

     5041 tttttccata ggctccgccc ccctgacgag catcacaaaa atcgacgctc aagtcagagg

     5101 tggcgaaacc cgacaggact ataaagatac caggcgtttc cccctggaag ctccctcgtg

     5161 cgctctcctg ttccgaccct gccgcttacc ggatacctgt ccgcctttct cccttcggga

     5221 agcgtggcgc tttctcatag ctcacgctgt aggtatctca gttcggtgta ggtcgttcgc

     5281 tccaagctgg gctgtgtgca cgaacccccc gttcagcccg accgctgcgc cttatccggt

     5341 aactatcgtc ttgagtccaa cccggtaaga cacgacttat cgccactggc agcagccact

     5401 ggtaacagga ttagcagagc gaggtatgta ggcggtgcta cagagttctt gaagtggtgg

     5461 cctaactacg gctacactag aaggacagta tttggtatct gcgctctgct gaagccagtt

     5521 accttcggaa aaagagttgg tagctcttga tccggcaaac aaaccaccgc tggtagcggt

     5581 ggtttttttg tttgcaagca gcagattacg cgcagaaaaa aaggatctca agaagatcct

     5641 ttgatctttt ctacggggtc tgacgctcag tggaacgaaa actcacgtta agggattttg

     5701 gtcatgagat tatcaaaaag gatcttcacc tagatccttt taaattaaaa atgaagtttt

     5761 aaatcaatct aaagtatata tgagtaaact tggtctgaca gttaccaatg cttaatcagt

     5821 gaggcaccta tctcagcgat ctgtctattt cgttcatcca tagttgcctg actccccgtc

     5881 gtgtagataa ctacgatacg ggagggctta ccatctggcc ccagtgctgc aatgataccg

     5941 cgagacccac gctcaccggc tccagattta tcagcaataa accagccagc cggaagggcc

     6001 gagcgcagaa gtggtcctgc aactttatcc gcctccatcc agtctattaa ttgttgccgg

     6061 gaagctagag taagtagttc gccagttaat agtttgcgca acgttgttgc cattgctaca

     6121 ggcatcgtgg tgtcacgctc gtcgtttggt atggcttcat tcagctccgg ttcccaacga

     6181 tcaaggcgag ttacatgatc ccccatgttg tgcaaaaaag cggttagctc cttcggtcct

     6241 ccgatcgttg tcagaagtaa gttggccgca gtgttatcac tcatggttat ggcagcactg

     6301 cataattctc ttactgtcat gccatccgta agatgctttt ctgtgactgg tgagtactca

     6361 accaagtcat tctgagaata gtgtatgcgg cgaccgagtt gctcttgccc ggcgtcaata

     6421 cgggataata ccgcgccaca tagcagaact ttaaaagtgc tcatcattgg aaaacgttct

     6481 tcggggcgaa aactctcaag gatcttaccg ctgttgagat ccagttcgat gtaacccact

     6541 cgtgcaccca actgatcttc agcatctttt actttcacca gcgtttctgg gtgagcaaaa

     6601 acaggaaggc aaaatgccgc aaaaaaggga ataagggcga cacggaaatg ttgaatactc

     6661 atactcttcc tttttcaata ttattgaagc atttatcagg gttattgtct catgagcgga

     6721 tacatatttg aatgtattta gaaaaataaa caaatagggg ttccgcgcac atttccccga

     6781 aaagtgccac ctgacgtcta agaaaccatt attatcatga cattaaccta taaaaatagg

     6841 cgtatcacga ggccctttcg tctcgcgcgt ttcggtgatg acggtgaaaa cctctgacac

     6901 atgcagctcc cggagacggt cacagcttgt ctgtaagcgg atgccgggag cagacaagcc

     6961 cgtcagggcg cgtcagcggg tgttggcggg tgtcggggct ggcttaacta tgcggcatca

     7021 gagcagattg tactgagagt gcaccatatg cggtgtgaaa taccgcacag atgcgtaagg

     7081 agaaaatacc gcatcaggcg ccattcgcca ttcaggctgc gcaactgttg ggaagggcga

     7141 tcggtgcggg cctcttcgct attacgccag ctggcgaaag ggggatgtgc tgcaaggcga

     7201 ttaagttggg taacgccagg gttttcccag tcacgacgtt gtaaaacgac ggccagtgcc

     7261 aagctg

//

 

Caution:
Product is for research use only!

 

Search name

pCDH-EF1-MCS-T2A-copGFP,Plasmid pCDH-EF1-MCS-T2A-copGFP,pCDH-EF1-MCS-T2A-copGFP vector

No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart