pCDH- EF1- MCS- T2A- copGFP Plasmid

$216.00

  • Model: PVT2336
  • 50 Units in Stock
Ask a question


Add to Cart:

pCDH-EF1-MCS-T2A-copGFP

Search name

pCDH-EF1-MCS-T2A-copGFP,Plasmid pCDH-EF1-MCS-T2A-copGFP,pCDH-EF1-MCS-T2A-copGFP vector

 

pCDH-EF1-MCS-T2A-copGFP Information

Promoter: EF-1 alpha core

Replicator: pUC ori, SV40 ori

Terminator: SV40 poly (A) signal

Plasmid classification: virus series, lentivirus cloning vector

Plasmid size: 7266bp

Prokaryotic resistance: Amp

Cloned strain: Stbl3

Culture conditions: 37 centigrade, aerobic LB

Expression host: mammalian cells

Induction mode: no induction, instantaneous expression

5'sequencing primers: primers designed according to sequence

3'sequencing primers: primers designed according to sequence

Use:Lentiviral

 

pCDH-EF1-MCS-T2A-copGFP Description

Stable overexpression with cDNA lentivectors Strong and ubiquitous expression of the gene of interestSingle or double expression cassette with choice of reporter geneTarget gene expressed from CMV, EF1, or MSCV promoter Choose from FIV- or HIV-based vectors Gene expression from constitutive promoters,The multiple cloning site (MCS) located downstream of an internal promoter allows convenient cloning of your gene of interest.

pCDH-EF1-MCS-T2A-copGFP-vector

 

 

pCDH-EF1-MCS-T2A-copGFP Sequence

LOCUS       Exported                7266 bp ds-DNA     circular SYN 05-AUG-2016
DEFINITION  synthetic circular DNA
ACCESSION   .
VERSION     .
KEYWORDS    pCDH-EF1-MCS-T2A-copGFP (CD521A-1)
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 7266)
  AUTHORS   .
  TITLE     Direct Submission
  JOURNAL   Exported Thursday, September 8, 2016 from SnapGene Viewer 3.1.4
FEATURES             Location/Qualifiers
     source          1..7266
                     /organism="synthetic DNA construct"
                     /mol_type="other DNA"
     LTR             234..414
                     /note="5' LTR (truncated)"
                     /note="truncated 5' long terminal repeat (LTR) from HIV-1"
     misc_feature    458..583
                     /note="HIV-1 Psi"
                     /note="packaging signal of human immunodeficiency virus 
                     type 1"
     misc_feature    1076..1309
                     /note="RRE"
                     /note="The Rev response element (RRE) of HIV-1 allows for 
                     Rev-dependent mRNA export from the nucleus to the 
                     cytoplasm."
     misc_feature    1804..1921
                     /note="cPPT/CTS"
                     /note="central polypurine tract and central termination 
                     sequence of HIV-1"
     promoter        1966..2177
                     /note="EF-1-alpha core promoter"
                     /note="core promoter for human elongation factor 
                     EF-1-alpha"
     LTR             2190..2458
                     /note="5' LTR (truncated)"
                     /note="truncated 5' long terminal repeat (LTR) from human 
                     T-cell leukemia virus (HTLV) type 1"
     CDS             2524..2577
                     /codon_start=1
                     /product="2A peptide from Thosea asigna virus capsid 
                     protein"
                     /note="T2A"
                     /note="Eukaryotic ribosomes fail to insert a peptide bond 
                     between the Gly and Pro residues, yielding separate 
                     polypeptides."
                     /translation="EGRGSLLTCGDVEENPGP"
     CDS             2608..3270
                     /codon_start=1
                     /product="green fluorescent protein 2 from Pontellina 
                     plumata, also known as ppluGFP2 (Shagin et al., 2004)"
                     /note="CopGFP"
                     /translation="PAMEIECRITGTLNGVEFELVGGGEGTPKQGRMTNKMKSTKGALT
                     FSPYLLSHVMGYGFYHFGTYPSGYENPFLHAINNGGYTNTRIEKYEDGGVLHVSFSYRY
                     EAGRVIGDFKVVGTGFPEDSVIFTDKIIRSNATVEHLHPMGDNVLVGSFARTFSLRDGG
                     YYSFVVDSHMHFKSAIHPSILQNGGPMFAFRRVEELHSNTELGIVEYQHAFKTPIAFA"
     misc_feature    3361..3949
                     /note="WPRE"
                     /note="woodchuck hepatitis virus posttranscriptional 
                     regulatory element"
     CDS             complement(3832..3843)
                     /codon_start=1
                     /product="Factor Xa recognition and cleavage site"
                     /note="Factor Xa site"
                     /translation="IEGR"
     LTR             4023..4256
                     /note="3' LTR (Delta-U3)"
                     /note="self-inactivating 3' long terminal repeat (LTR) from
                     HIV-1"
     polyA_signal    4328..4449
                     /note="SV40 poly(A) signal"
                     /note="SV40 polyadenylation signal"
     rep_origin      4468..4603
                     /note="SV40 ori"
                     /note="SV40 origin of replication"
     primer_bind     complement(4641..4657)
                     /note="M13 rev"
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     protein_bind    4665..4681
                     /bound_moiety="lac repressor encoded by lacI"
                     /note="lac operator"
                     /note="The lac repressor binds to the lac operator to 
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     promoter        complement(4689..4719)
                     /note="lac promoter"
                     /note="promoter for the E. coli lac operon"
     protein_bind    4734..4755
                     /bound_moiety="E. coli catabolite activator protein"
                     /note="CAP binding site"
                     /note="CAP binding activates transcription in the presence 
                     of cAMP."
     rep_origin      complement(5043..5631)
                     /direction=LEFT
                     /note="ori"
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     CDS             complement(5802..6662)
                     /codon_start=1
No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart