pCDH-CMV-MCS-EF1-Puro-FLAG-HIF2 alpha

$260.00

  • Model: PVT12166
  • 20 Units in Stock
Ask a question


Add to Cart:

pCDH-CMV-MCS-EF1-Puro-FLAG-HIF2 alpha

PVT12166    2ug
 

 

pCDH-CMV-MCS-EF1-Puro-FLAG-HIF2 alpha Information

Bacterial Resistance(s):   Amp

Selectable markers: Puro 
Growth Strain(s): Stbl3
Growth Condition: LB/37 Centigrade

Alternative name: NM 001430.4 EPAS1 BHLHe73; ECYT4;

 

pCDH-CMV-MCS-EF1-Puro-FLAG-HIF2 alpha Sequence

LOCUS       Exported               10010 bp ds-DNA     circular SYN 06-JUL-2018

DEFINITION  synthetic circular DNA

ACCESSION   .

VERSION     .

KEYWORDS    pCDH-CMV-MCS-EF1-Puro-Flag-HIF2-alpha

SOURCE      synthetic DNA construct

  ORGANISM  synthetic DNA construct

REFERENCE   1  (bases 1 to 10010)

  AUTHORS   .

  TITLE     Direct Submission

FEATURES             Location/Qualifiers

     source          1..10010

                     /organism="synthetic DNA construct"

                     /mol_type="other DNA"

     LTR             234..414

                     /note="5' LTR (truncated)"

                     /note="truncated 5' long terminal repeat (LTR) from HIV-1"

     misc_feature    458..583

                     /note="HIV-1 Psi"

                     /note="packaging signal of human immunodeficiency virus 

                     type 1"

     misc_feature    1076..1309

                     /note="RRE"

                     /note="The Rev response element (RRE) of HIV-1 allows for 

                     Rev-dependent mRNA export from the nucleus to the 

                     cytoplasm."

     misc_feature    1804..1920

                     /note="cPPT/CTS"

                     /note="central polypurine tract and central termination 

                     sequence of HIV-1"

     promoter        2010..2213

                     /note="CMV promoter"

                     /note="human cytomegalovirus (CMV) immediate early 

                     promoter"

     regulatory      2290..2299

                     /regulatory_class="other"

                     /note="Kozak sequence"

                     /note="vertebrate consensus sequence for strong initiation 

                     of translation (Kozak, 1987)"

     CDS             2299..2322

                     /codon_start=1

                     /product="FLAG(R) epitope tag, followed by an enterokinase 

                     cleavage site"

                     /note="FLAG"

                     /translation="DYKDDDDK"

     misc_feature    2323..4932

                     /note="HIF2-alpha"

     promoter        4980..5191

                     /note="EF-1-alpha core promoter"

                     /note="core promoter for human elongation factor 

                     EF-1-alpha"

     LTR             5204..5472

                     /note="5' LTR (truncated)"

                     /note="truncated 5' long terminal repeat (LTR) from human 

                     T-cell leukemia virus (HTLV) type 1"

     CDS             5499..6098

                     /codon_start=1

                     /gene="pac from Streptomyces alboniger"

                     /product="puromycin N-acetyltransferase"

                     /note="PuroR"

                     /note="confers resistance to puromycin"

                     /translation="MTEYKPTVRLATRDDVPRAVRTLAAAFADYPATRHTVDPDRHIER

                     VTELQELFLTRVGLDIGKVWVADDGAAVAVWTTPESVEAGAVFAEIGPRMAELSGSRLA

                     AQQQMEGLLAPHRPKEPAWFLATVGVSPDHQGKGLGSAVVLPGVEAAERAGVPAFLETS

                     APRNLPFYERLGFTVTADVEVPEGPRTWCMTRKPGA"

     misc_feature    6105..6693

                     /note="WPRE"

                     /note="woodchuck hepatitis virus posttranscriptional 

                     regulatory element"

     LTR             6767..7000

                     /note="3' LTR (Delta-U3)"

                     /note="self-inactivating 3' long terminal repeat (LTR) from

                     HIV-1"

     polyA_signal    7072..7193

                     /note="SV40 poly(A) signal"

                     /note="SV40 polyadenylation signal"

     rep_origin      7212..7347

                     /note="SV40 ori"

                     /note="SV40 origin of replication"

     rep_origin      complement(7787..8375)

                     /direction=LEFT

                     /note="ori"

                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 

                     replication"

     CDS             complement(8546..9406)

                     /codon_start=1

                     /gene="bla"

                     /product="beta-lactamase"

                     /note="AmpR"

                     /note="confers resistance to ampicillin, carbenicillin, and

                     related antibiotics"

                     /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI

                     ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVEYS

                     PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW

                     EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA

                     LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS

                     LIKHW"

     promoter        complement(9407..9511)

                     /gene="bla"

                     /note="AmpR promoter"

ORIGIN

        1 acgcgtgtag tcttatgcaa tactcttgta gtcttgcaac atggtaacga tgagttagca

       61 acatgcctta caaggagaga aaaagcaccg tgcatgccga ttggtggaag taaggtggta

      121 cgatcgtgcc ttattaggaa ggcaacagac gggtctgaca tggattggac gaaccactga

      181 attgccgcat tgcagagata ttgtatttaa gtgcctagct cgatacaata aacgggtctc

      241 tctggttaga ccagatctga gcctgggagc tctctggcta actagggaac ccactgctta

      301 agcctcaata aagcttgcct tgagtgcttc aagtagtgtg tgcccgtctg ttgtgtgact

      361 ctggtaacta gagatccctc agaccctttt agtcagtgtg gaaaatctct agcagtggcg

      421 cccgaacagg gacctgaaag cgaaagggaa accagagctc tctcgacgca ggactcggct

      481 tgctgaagcg cgcacggcaa gaggcgaggg gcggcgactg gtgagtacgc caaaaatttt

      541 gactagcgga ggctagaagg agagagatgg gtgcgagagc gtcagtatta agcgggggag

      601 aattagatcg cgatgggaaa aaattcggtt aaggccaggg ggaaagaaaa aatataaatt

      661 aaaacatata gtatgggcaa gcagggagct agaacgattc gcagttaatc ctggcctgtt

      721 agaaacatca gaaggctgta gacaaatact gggacagcta caaccatccc ttcagacagg

      781 atcagaagaa cttagatcat tatataatac agtagcaacc ctctattgtg tgcatcaaag

      841 gatagagata aaagacacca aggaagcttt agacaagata gaggaagagc aaaacaaaag

      901 taagaccacc gcacagcaag cggccactga tcttcagacc tggaggagga gatatgaggg

      961 acaattggag aagtgaatta tataaatata aagtagtaaa aattgaacca ttaggagtag

     1021 cacccaccaa ggcaaagaga agagtggtgc agagagaaaa aagagcagtg ggaataggag

     1081 ctttgttcct tgggttcttg ggagcagcag gaagcactat gggcgcagcc tcaatgacgc

     1141 tgacggtaca ggccagacaa ttattgtctg gtatagtgca gcagcagaac aatttgctga

     1201 gggctattga ggcgcaacag catctgttgc aactcacagt ctggggcatc aagcagctcc

     1261 aggcaagaat cctggctgtg gaaagatacc taaaggatca acagctcctg gggatttggg

     1321 gttgctctgg aaaactcatt tgcaccactg ctgtgccttg gaatgctagt tggagtaata

     1381 aatctctgga acagattgga atcacacgac ctggatggag tgggacagag aaattaacaa

     1441 ttacacaagc ttaatacact ccttaattga agaatcgcaa aaccagcaag aaaagaatga

     1501 acaagaatta ttggaattag ataaatgggc aagtttgtgg aattggttta acataacaaa

     1561 ttggctgtgg tatataaaat tattcataat gatagtagga ggcttggtag gtttaagaat

     1621 agtttttgct gtactttcta tagtgaatag agttaggcag ggatattcac cattatcgtt

     1681 tcagacccac ctcccaaccc cgaggggacc cgacaggccc gaaggaatag aagaagaagg

     1741 tggagagaga gacagagaca gatccattcg attagtgaac ggatctcgac ggtatcggtt

     1801 aacttttaaa agaaaagggg ggattggggg gtacagtgca ggggaaagaa tagtagacat

     1861 aatagcaaca gacatacaaa ctaaagaatt acaaaaacaa attacaaaat tcaaaatttt

     1921 atcgatacta gtattatgcc cagtacatga ccttatggga ctttcctact tggcagtaca

     1981 tctacgtatt agtcatcgct attaccatgg tgatgcggtt ttggcagtac atcaatgggc

     2041 gtggatagcg gtttgactca cggggatttc caagtctcca ccccattgac gtcaatggga

     2101 gtttgttttg gcaccaaaat caacgggact ttccaaaatg tcgtaacaac tccgccccat

     2161 tgacgcaaat gggcggtagg cgtgtacggt gggaggttta tataagcaga gctcgtttag

     2221 tgaaccgtca gatcgcctgg agacgccatc cacgctgttt tgacctccat agaagattct

     2281 agagctagcg ccaccatgga ttacaaggat gacgacgata agacagctga caaggagaag

     2341 aaaaggagta gctcggagag gaggaaggag aagtcccggg atgctgcgcg gtgccggcgg

     2401 agcaaggaga cggaggtgtt ctatgagctg gcccatgagc tgcctctgcc ccacagtgtg

     2461 agctcccatc tggacaaggc ctccatcatg cgactggcaa tcagcttcct gcgaacacac

     2521 aagctcctct cctcagtttg ctctgaaaac gagtccgaag ccgaagctga ccagcagatg

     2581 gacaacttgt acctgaaagc cttggagggt ttcattgccg tggtgaccca agatggcgac

     2641 atgatctttc tgtcagaaaa catcagcaag ttcatgggac ttacacaggt ggagctaaca

     2701 ggacatagta tctttgactt cactcatccc tgcgaccatg aggagattcg tgagaacctg

     2761 agtctcaaaa atggctctgg ttttgggaaa aaaagcaaag acatgtccac agagcgggac

     2821 ttcttcatga ggatgaagtg cacggtcacc aacagaggcc gtactgtcaa cctcaagtca

     2881 gccacctgga aggtcttgca ctgcacgggc caggtgaaag tctacaacaa ctgccctcct

     2941 cacaatagtc tgtgtggcta caaggagccc ctgctgtcct gcctcatcat catgtgtgaa

     3001 ccaatccagc acccatccca catggacatc cccctggata gcaagacctt cctgagccgc

     3061 cacagcatgg acatgaagtt cacctactgt gatgacagaa tcacagaact gattggttac

     3121 caccctgagg agctgcttgg ccgctcagcc tatgaattct accatgcgct agactccgag

     3181 aacatgacca agagtcacca gaacttgtgc accaagggtc aggtagtaag tggccagtac

     3241 cggatgctcg caaagcatgg gggctacgtg tggctggaga cccaggggac ggtcatctac

     3301 aaccctcgca acctgcagcc ccagtgcatc atgtgtgtca actacgtcct gagtgagatt

     3361 gagaagaatg acgtggtgtt ctccatggac cagactgaat ccctgttcaa gccccacctg

     3421 atggccatga acagcatctt tgatagcagt ggcaaggggg ctgtgtctga gaagagtaac

     3481 ttcctattca ccaagctaaa ggaggagccc gaggagctgg cccagctggc tcccacccca

     3541 ggagacgcca tcatctctct ggatttcggg aatcagaact tcgaggagtc ctcagcctat

     3601 ggcaaggcca tcctgccccc gagccagcca tgggccacgg agttgaggag ccacagcacc

     3661 cagagcgagg ctgggagcct gcctgccttc accgtgcccc aggcagctgc cccgggcagc

     3721 accaccccca gtgccaccag cagcagcagc agctgctcca cgcccaatag ccctgaagac

     3781 tattacacat ctttggataa cgacctgaag attgaagtga ttgagaagct cttcgccatg

     3841 gacacagagg ccaaggacca atgcagtacc cagacggatt tcaatgagct ggacttggag

     3901 acactggcac cctatatccc catggacggg gaagacttcc agctaagccc catctgcccc

     3961 gaggagcggc tcttggcgga gaacccacag tccacccccc agcactgctt cagtgccatg

     4021 acaaacatct tccagccact ggcccctgta gccccgcaca gtcccttcct cctggacaag

     4081 tttcagcagc agctggagag caagaagaca gagcccgagc accggcccat gtcctccatc

     4141 ttctttgatg ccggaagcaa agcatccctg ccaccgtgct gtggccaggc cagcacccct

     4201 ctctcttcca tggggggcag atccaatacc cagtggcccc cagatccacc attacatttt

     4261 gggcccacaa agtgggccgt cggggatcag cgcacagagt tcttgggagc agcgccgttg

     4321 gggccccctg tctctccacc ccatgtctcc accttcaaga caaggtctgc aaagggtttt

     4381 ggggctcgag gcccagacgt gctgagtccg gccatggtag ccctctccaa caagctgaag

     4441 ctgaagcgac agctggagta tgaagagcaa gccttccagg acctgagcgg gggggaccca

     4501 cctggtggca gcacctcaca tttgatgtgg aaacggatga agaacctcag gggtgggagc

     4561 tgccctttga tgccggacaa gccactgagc gcaaatgtac ccaatgataa gttcacccaa

     4621 aaccccatga ggggcctggg ccatcccctg agacatctgc cgctgccaca gcctccatct

     4681 gccatcagtc ccggggagaa cagcaagagc aggttccccc cacagtgcta cgccacccag

     4741 taccaggact acagcctgtc gtcagcccac aaggtgtcag gcatggcaag ccggctgctc

     4801 gggccctcat ttgagtccta cctgctgccc gaactgacca gatatgactg tgaggtgaac

     4861 gtgcccgtgc tgggaagctc cacgctcctg caaggagggg acctcctcag agccctggac

     4921 caggccacct gaggatccgc ggccgcgaag gatctgcgat cgctccggtg cccgtcagtg

     4981 ggcagagcgc acatcgccca cagtccccga gaagttgggg ggaggggtcg gcaattgaac

     5041 gggtgcctag agaaggtggc gcggggtaaa ctgggaaagt gatgtcgtgt actggctccg

     5101 cctttttccc gagggtgggg gagaaccgta tataagtgca gtagtcgccg tgaacgttct

     5161 ttttcgcaac gggtttgccg ccagaacaca gctgaagctt cgaggggctc gcatctctcc

     5221 ttcacgcgcc cgccgcccta cctgaggccg ccatccacgc cggttgagtc gcgttctgcc

     5281 gcctcccgcc tgtggtgcct cctgaactgc gtccgccgtc taggtaagtt taaagctcag

     5341 gtcgagaccg ggcctttgtc cggcgctccc ttggagccta cctagactca gccggctctc

     5401 cacgctttgc ctgaccctgc ttgctcaact ctacgtcttt gtttcgtttt ctgttctgcg

     5461 ccgttacaga tccaagctgt gaccggcgcc tacgctagat gaccgagtac aagcccacgg

     5521 tgcgcctcgc cacccgcgac gacgtcccca gggccgtacg caccctcgcc gccgcgttcg

     5581 ccgactaccc cgccacgcgc cacaccgtcg atccggaccg ccacatcgag cgggtcaccg

     5641 agctgcaaga actcttcctc acgcgcgtcg ggctcgacat cggcaaggtg tgggtcgcgg

     5701 acgacggcgc cgcggtggcg gtctggacca cgccggagag cgtcgaagcg ggggcggtgt

     5761 tcgccgagat cggcccgcgc atggccgagt tgagcggttc ccggctggcc gcgcagcaac

     5821 agatggaagg cctcctggcg ccgcaccggc ccaaggagcc cgcgtggttc ctggccaccg

     5881 tcggcgtctc gcccgaccac cagggcaagg gtctgggcag cgccgtcgtg ctccccggag

     5941 tggaggcggc cgagcgcgcc ggggtgcccg ccttcctgga gacctccgcg ccccgcaacc

     6001 tccccttcta cgagcggctc ggcttcaccg tcaccgccga cgtcgaggtg cccgaaggac

     6061 cgcgcacctg gtgcatgacc cgcaagcccg gtgcctgagt cgacaatcaa cctctggatt

     6121 acaaaatttg tgaaagattg actggtattc ttaactatgt tgctcctttt acgctatgtg

     6181 gatacgctgc tttaatgcct ttgtatcatg ctattgcttc ccgtatggct ttcattttct

     6241 cctccttgta taaatcctgg ttgctgtctc tttatgagga gttgtggccc gttgtcaggc

     6301 aacgtggcgt ggtgtgcact gtgtttgctg acgcaacccc cactggttgg ggcattgcca

     6361 ccacctgtca gctcctttcc gggactttcg ctttccccct ccctattgcc acggcggaac

     6421 tcatcgccgc ctgccttgcc cgctgctgga caggggctcg gctgttgggc actgacaatt

     6481 ccgtggtgtt gtcggggaaa tcatcgtcct ttccttggct gctcgcctgt gttgccacct

     6541 ggattctgcg cgggacgtcc ttctgctacg tcccttcggc cctcaatcca gcggaccttc

     6601 cttcccgcgg cctgctgccg gctctgcggc ctcttccgcg tcttcgcctt cgccctcaga

     6661 cgagtcggat ctccctttgg gccgcctccc cgcctggtac ctttaagacc aatgacttac

     6721 aaggcagctg tagatcttag ccacttttta aaagaaaagg ggggactgga agggctaatt

     6781 cactcccaac gaaaataaga tctgcttttt gcttgtactg ggtctctctg gttagaccag

     6841 atctgagcct gggagctctc tggctaacta gggaacccac tgcttaagcc tcaataaagc

     6901 ttgccttgag tgcttcaagt agtgtgtgcc cgtctgttgt gtgactctgg taactagaga

     6961 tccctcagac ccttttagtc agtgtggaaa atctctagca gtagtagttc atgtcatctt

     7021 attattcagt atttataact tgcaaagaaa tgaatatcag agagtgagag gaacttgttt

     7081 attgcagctt ataatggtta caaataaagc aatagcatca caaatttcac aaataaagca

     7141 tttttttcac tgcattctag ttgtggtttg tccaaactca tcaatgtatc ttatcatgtc

     7201 tggctctagc tatcccgccc ctaactccgc ccagttccgc ccattctccg ccccatggct

     7261 gactaatttt ttttatttat gcagaggccg aggccgcctc ggcctctgag ctattccaga

     7321 agtagtgagg aggctttttt ggaggcctag acttttgcag agacggccca aattcgtaat

     7381 catggtcata gctgtttcct gtgtgaaatt gttatccgct cacaattcca cacaacatac

     7441 gagccggaag cataaagtgt aaagcctggg gtgcctaatg agtgagctaa ctcacattaa

     7501 ttgcgttgcg ctcactgccc gctttccagt cgggaaacct gtcgtgccag ctgcattaat

     7561 gaatcggcca acgcgcgggg agaggcggtt tgcgtattgg gcgctcttcc gcttcctcgc

     7621 tcactgactc gctgcgctcg gtcgttcggc tgcggcgagc ggtatcagct cactcaaagg

     7681 cggtaatacg gttatccaca gaatcagggg ataacgcagg aaagaacatg tgagcaaaag

     7741 gccagcaaaa ggccaggaac cgtaaaaagg ccgcgttgct ggcgtttttc cataggctcc

     7801 gcccccctga cgagcatcac aaaaatcgac gctcaagtca gaggtggcga aacccgacag

     7861 gactataaag ataccaggcg tttccccctg gaagctccct cgtgcgctct cctgttccga

     7921 ccctgccgct taccggatac ctgtccgcct ttctcccttc gggaagcgtg gcgctttctc

     7981 atagctcacg ctgtaggtat ctcagttcgg tgtaggtcgt tcgctccaag ctgggctgtg

     8041 tgcacgaacc ccccgttcag cccgaccgct gcgccttatc cggtaactat cgtcttgagt

     8101 ccaacccggt aagacacgac ttatcgccac tggcagcagc cactggtaac aggattagca

     8161 gagcgaggta tgtaggcggt gctacagagt tcttgaagtg gtggcctaac tacggctaca

     8221 ctagaaggac agtatttggt atctgcgctc tgctgaagcc agttaccttc ggaaaaagag

     8281 ttggtagctc ttgatccggc aaacaaacca ccgctggtag cggtggtttt tttgtttgca

     8341 agcagcagat tacgcgcaga aaaaaaggat ctcaagaaga tcctttgatc ttttctacgg

     8401 ggtctgacgc tcagtggaac gaaaactcac gttaagggat tttggtcatg agattatcaa

     8461 aaaggatctt cacctagatc cttttaaatt aaaaatgaag ttttaaatca atctaaagta

     8521 tatatgagta aacttggtct gacagttacc aatgcttaat cagtgaggca cctatctcag

     8581 cgatctgtct atttcgttca tccatagttg cctgactccc cgtcgtgtag ataactacga

     8641 tacgggaggg cttaccatct ggccccagtg ctgcaatgat accgcgagac ccacgctcac

     8701 cggctccaga tttatcagca ataaaccagc cagccggaag ggccgagcgc agaagtggtc

     8761 ctgcaacttt atccgcctcc atccagtcta ttaattgttg ccgggaagct agagtaagta

     8821 gttcgccagt taatagtttg cgcaacgttg ttgccattgc tacaggcatc gtggtgtcac

     8881 gctcgtcgtt tggtatggct tcattcagct ccggttccca acgatcaagg cgagttacat

     8941 gatcccccat gttgtgcaaa aaagcggtta gctccttcgg tcctccgatc gttgtcagaa

     9001 gtaagttggc cgcagtgtta tcactcatgg ttatggcagc actgcataat tctcttactg

     9061 tcatgccatc cgtaagatgc ttttctgtga ctggtgagta ctcaaccaag tcattctgag

     9121 aatagtgtat gcggcgaccg agttgctctt gcccggcgtc aatacgggat aataccgcgc

     9181 cacatagcag aactttaaaa gtgctcatca ttggaaaacg ttcttcgggg cgaaaactct

     9241 caaggatctt accgctgttg agatccagtt cgatgtaacc cactcgtgca cccaactgat

     9301 cttcagcatc ttttactttc accagcgttt ctgggtgagc aaaaacagga aggcaaaatg

     9361 ccgcaaaaaa gggaataagg gcgacacgga aatgttgaat actcatactc ttcctttttc

     9421 aatattattg aagcatttat cagggttatt gtctcatgag cggatacata tttgaatgta

     9481 tttagaaaaa taaacaaata ggggttccgc gcacatttcc ccgaaaagtg ccacctgacg

     9541 tctaagaaac cattattatc atgacattaa cctataaaaa taggcgtatc acgaggccct

     9601 ttcgtctcgc gcgtttcggt gatgacggtg aaaacctctg acacatgcag ctcccggaga

     9661 cggtcacagc ttgtctgtaa gcggatgccg ggagcagaca agcccgtcag ggcgcgtcag

     9721 cgggtgttgg cgggtgtcgg ggctggctta actatgcggc atcagagcag attgtactga

     9781 gagtgcacca tatgcggtgt gaaataccgc acagatgcgt aaggagaaaa taccgcatca

     9841 ggcgccattc gccattcagg ctgcgcaact gttgggaagg gcgatcggtg cgggcctctt

     9901 cgctattacg ccagctggcg aaagggggat gtgctgcaag gcgattaagt tgggtaacgc

     9961 cagggttttc ccagtcacga cgttgtaaaa cgacggccag tgccaagctg

//

 


Caution:
Product is for research use only!

 

pCDH-CMV-MCS-EF1-Puro-FLAG-HIF2 alpha Search name

pCDH-CMV-MCS-EF1-Puro-FLAG-HIF2 alpha,pCDH-CMV-MCS-EF1-Puro-FLAG-HIF2 alpha vector,pCDH-CMV-MCS-EF1-Puro-FLAG-HIF2 alpha plasmid,pCDH-CMV-MCS-EF1-Puro-FLAG-HIF2 alpha map

No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart