pCDNA3.1-EGFP-2

$193.00

  • Model: PVT10755
  • 50 Units in Stock
Ask a question


Add to Cart:

pCDNA3.1-EGFP

PVT10755     Packing 2ug

 

pCDNA3.1-EGFP Informaiton

Prokaryotic resistance: ampicillin Amp

Screening marker: hereditary mycin G418, green fluorescent protein EGFP

Clone strain: Escherichia coli DH5 alpha

Culture conditions: 37 C

Note: Restriction site is different from pCDNA3.1-EGFP(PVT10754)
 

pCDNA3.1-EGFP Description

PCDNA3.1-EGFP is a green fluorescent expression plasmid of mammalian cells.

 

pCDNA3.1-EGFP Sequence

LOCUS       Exported                6095 bp ds-DNA     circular SYN 08-DEC-2017

DEFINITION  synthetic circular DNA

FEATURES             Location/Qualifiers

     source          1..6095

                     /organism="synthetic DNA construct"

                     /mol_type="other DNA"

     enhancer        202..581

                     /label=CMV enhancer

                     /note="human cytomegalovirus immediate early enhancer"

     promoter        582..785

                     /label=CMV promoter

                     /note="human cytomegalovirus (CMV) immediate early 

                     promoter"

     promoter        830..848

                     /label=T7 promoter

                     /note="promoter for bacteriophage T7 RNA polymerase"

     CDS             902..1618

                     /codon_start=1

                     /product="enhanced GFP"

                     /label=EGFP

                     /note="mammalian codon-optimized"

                     /translation="MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTL

                     KFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDD

                     GNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIK

                     VNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLL

                     EFVTAAGITLGMDELYK"

     polyA_signal    1662..1886

                     /label=bGH poly(A) signal

                     /note="bovine growth hormone polyadenylation signal"

     rep_origin      1932..2360

                     /direction=RIGHT

                     /label=f1 ori

                     /note="f1 bacteriophage origin of replication; arrow 

                     indicates direction of (+) strand synthesis"

     promoter        2374..2703

                     /label=SV40 promoter

                     /note="SV40 enhancer and early promoter"

     rep_origin      2554..2689

                     /label=SV40 ori

                     /note="SV40 origin of replication"

     CDS             2770..3564

                     /codon_start=1

                     /gene="aph(3')-II (or nptII)"

                     /product="aminoglycoside phosphotransferase from Tn5"

                     /label=NeoR/KanR

                     /note="confers resistance to neomycin, kanamycin, and G418 

                     (Geneticin(R))"

                     /translation="MIEQDGLHAGSPAAWVERLFGYDWAQQTIGCSDAAVFRLSAQGRP

                     VLFVKTDLSGALNELQDEAARLSWLATTGVPCAAVLDVVTEAGRDWLLLGEVPGQDLLS

                     SHLAPAEKVSIMADAMRRLHTLDPATCPFDHQAKHRIERARTRMEAGLVDQDDLDEEHQ

                     GLAPAELFARLKARMPDGEDLVVTHGDACLPNIMVENGRFSGFIDCGRLGVADRYQDIA

                     LATRDIAEELGGEWADRFLVLYGIAAPDSQRIAFYRLLDEFF"

     polyA_signal    3738..3859

                     /label=SV40 poly(A) signal

                     /note="SV40 polyadenylation signal"

     protein_bind    3932..3948

                     /label=lac operator

                     /bound_moiety="lac repressor encoded by lacI"

                     /note="The lac repressor binds to the lac operator to 

                     inhibit transcription in E. coli. This inhibition can be 

                     relieved by adding lactose or 

                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."

     promoter        complement(3956..3986)

                     /label=lac promoter

                     /note="promoter for the E. coli lac operon"

     protein_bind    4001..4022

                     /label=CAP binding site

                     /bound_moiety="E. coli catabolite activator protein"

                     /note="CAP binding activates transcription in the presence 

                     of cAMP."

     rep_origin      complement(4310..4895)

                     /direction=LEFT

                     /label=ori

                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 

                     replication"

     CDS             complement(5066..5926)

                     /codon_start=1

                     /gene="bla"

                     /product="beta-lactamase"

                     /label=AmpR

                     /note="confers resistance to ampicillin, carbenicillin, and

                     related antibiotics"

                     /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI

                     ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVEYS

                     PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW

                     EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA

                     LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS

                     LIKHW"

     promoter        complement(5927..6031)

                     /gene="bla"

                     /label=AmpR promoter

ORIGIN

        1 gcactctcag tacaatctgc tctgatgccg catagttaag ccagtatctg ctccctgctt

       61 gtgtgttgga ggtcgctgag tagtgcgcga gcaaaattta agctacaaca aggcaaggct

      121 tgaccgacaa ttgcatgaag aatctgctta gggttaggcg ttttgcgctg cttcgcgatg

      181 tacgggccag atatacgcgt tgacattgat tattgactag ttattaatag taatcaatta

      241 cggggtcatt agttcatagc ccatatatgg agttccgcgt tacataactt acggtaaatg

      301 gcccgcctgg ctgaccgccc aacgaccccc gcccattgac gtcaataatg acgtatgttc

      361 ccatagtaac gccaataggg actttccatt gacgtcaatg ggtggagtat ttacggtaaa

      421 ctgcccactt ggcagtacat caagtgtatc atatgccaag tacgccccct attgacgtca

      481 atgacggtaa atggcccgcc tggcattatg cccagtacat gaccttatgg gactttccta

      541 cttggcagta catctacgta ttagtcatcg ctattaccat ggtgatgcgg ttttggcagt

      601 acatcaatgg gcgtggatag cggtttgact cacggggatt tccaagtctc caccccattg

      661 acgtcaatgg gagtttgttt tggcaccaaa atcaacggga ctttccaaaa tgtcgtaaca

      721 actccgcccc attgacgcaa atgggcggta ggcgtgtacg gtgggaggtc tatataagca

      781 gagctctctg gctaactaga gaacccactg cttactggct tatcgaaatt aatacgactc

      841 actataggga gacccaagct ggctagcgtt taaacttaag cttggtaccg agctcggatc

      901 catggtgagc aagggcgagg agctgttcac cggggtggtg cccatcctgg tcgagctgga

      961 cggcgacgta aacggccaca agttcagcgt gtccggcgag ggcgagggcg atgccaccta

     1021 cggcaagctg accctgaagt tcatctgcac caccggcaag ctgcccgtgc cctggcccac

     1081 cctcgtgacc accctgacct acggcgtgca gtgcttcagc cgctaccccg accacatgaa

     1141 gcagcacgac ttcttcaagt ccgccatgcc cgaaggctac gtccaggagc gcaccatctt

     1201 cttcaaggac gacggcaact acaagacccg cgccgaggtg aagttcgagg gcgacaccct

     1261 ggtgaaccgc atcgagctga agggcatcga cttcaaggag gacggcaaca tcctggggca

     1321 caagctggag tacaactaca acagccacaa cgtctatatc atggccgaca agcagaagaa

     1381 cggcatcaag gtgaacttca agatccgcca caacatcgag gacggcagcg tgcagctcgc

     1441 cgaccactac cagcagaaca cccccatcgg cgacggcccc gtgctgctgc ccgacaacca

     1501 ctacctgagc acccagtccg ccctgagcaa agaccccaac gagaagcgcg atcacatggt

     1561 cctgctggag ttcgtgaccg ccgccgggat cactctcggc atggacgagc tgtacaagct

     1621 cgagtctaga gggcccgttt aaacccgctg atcagcctcg actgtgcctt ctagttgcca

     1681 gccatctgtt gtttgcccct cccccgtgcc ttccttgacc ctggaaggtg ccactcccac

     1741 tgtcctttcc taataaaatg aggaaattgc atcgcattgt ctgagtaggt gtcattctat

     1801 tctggggggt ggggtggggc aggacagcaa gggggaggat tgggaagaca atagcaggca

     1861 tgctggggat gcggtgggct ctatggcttc tgaggcggaa agaaccagct ggggctctag

     1921 ggggtatccc cacgcgccct gtagcggcgc attaagcgcg gcgggtgtgg tggttacgcg

     1981 cagcgtgacc gctacacttg ccagcgccct agcgcccgct cctttcgctt tcttcccttc

     2041 ctttctcgcc acgttcgccg gctttccccg tcaagctcta aatcgggggc tccctttagg

     2101 gttccgattt agtgctttac ggcacctcga ccccaaaaaa cttgattagg gtgatggttc

     2161 acgtagtggg ccatcgccct gatagacggt ttttcgccct ttgacgttgg agtccacgtt

     2221 ctttaatagt ggactcttgt tccaaactgg aacaacactc aaccctatct cggtctattc

     2281 ttttgattta taagggattt tgccgatttc ggcctattgg ttaaaaaatg agctgattta

     2341 acaaaaattt aacgcgaatt aattctgtgg aatgtgtgtc agttagggtg tggaaagtcc

     2401 ccaggctccc cagcaggcag aagtatgcaa agcatgcatc tcaattagtc agcaaccagg

     2461 tgtggaaagt ccccaggctc cccagcaggc agaagtatgc aaagcatgca tctcaattag

     2521 tcagcaacca tagtcccgcc cctaactccg cccatcccgc ccctaactcc gcccagttcc

     2581 gcccattctc cgccccatgg ctgactaatt ttttttattt atgcagaggc cgaggccgcc

     2641 tctgcctctg agctattcca gaagtagtga ggaggctttt ttggaggcct aggcttttgc

     2701 aaaaagctcc cgggagcttg tatatccatt ttcggatctg atcaagagac aggatgagga

     2761 tcgtttcgca tgattgaaca agatggattg cacgcaggtt ctccggccgc ttgggtggag

     2821 aggctattcg gctatgactg ggcacaacag acaatcggct gctctgatgc cgccgtgttc

     2881 cggctgtcag cgcaggggcg cccggttctt tttgtcaaga ccgacctgtc cggtgccctg

     2941 aatgaactgc aggacgaggc agcgcggcta tcgtggctgg ccacgacggg cgttccttgc

     3001 gcagctgtgc tcgacgttgt cactgaagcg ggaagggact ggctgctatt gggcgaagtg

     3061 ccggggcagg atctcctgtc atctcacctt gctcctgccg agaaagtatc catcatggct

     3121 gatgcaatgc ggcggctgca tacgcttgat ccggctacct gcccattcga ccaccaagcg

     3181 aaacatcgca tcgagcgagc acgtactcgg atggaagccg gtcttgtcga tcaggatgat

     3241 ctggacgaag agcatcaggg gctcgcgcca gccgaactgt tcgccaggct caaggcgcgc

     3301 atgcccgacg gcgaggatct cgtcgtgacc catggcgatg cctgcttgcc gaatatcatg

     3361 gtggaaaatg gccgcttttc tggattcatc gactgtggcc ggctgggtgt ggcggaccgc

     3421 tatcaggaca tagcgttggc tacccgtgat attgctgaag agcttggcgg cgaatgggct

     3481 gaccgcttcc tcgtgcttta cggtatcgcc gctcccgatt cgcagcgcat cgccttctat

     3541 cgccttcttg acgagttctt ctgagcggga ctctggggtt cgaaatgacc gaccaagcga

     3601 cgcccaacct gccatcacga gatttcgatt ccaccgccgc cttctatgaa aggttgggct

     3661 tcggaatcgt tttccgggac gccggctgga tgatcctcca gcgcggggat ctcatgctgg

     3721 agttcttcgc ccaccccaac ttgtttattg cagcttataa tggttacaaa taaagcaata

     3781 gcatcacaaa tttcacaaat aaagcatttt tttcactgca ttctagttgt ggtttgtcca

     3841 aactcatcaa tgtatcttat catgtctgta taccgtcgac ctctagctag agcttggcgt

     3901 aatcatggtc atagctgttt cctgtgtgaa attgttatcc gctcacaatt ccacacaaca

     3961 tacgagccgg aagcataaag tgtaaagcct ggggtgccta atgagtgagc taactcacat

     4021 taattgcgtt gcgctcactg cccgctttcc agtcgggaaa cctgtcgtgc cagctgcatt

     4081 aatgaatcgg ccaacgcgcg gggagaggcg gtttgcgtat tgggcgctct tccgcttcct

     4141 cgctcactga ctcgctgcgc tcggtcgttc ggctgcggcg agcggtatca gctcactcaa

     4201 aggcggtaat acggttatcc acagaatcag gggataacgc aggaaagaac atgtgagcaa

     4261 aaggccagca aaaggccagg aaccgtaaaa aggccgcgtt gctggcgttt ttccataggc

     4321 tccgcccccc tgacgagcat cacaaaaatc gacgctcaag tcagaggtgg cgaaacccga

     4381 caggactata aagataccag gcgtttcccc ctggaagctc cctcgtgcgc tctcctgttc

     4441 cgaccctgcc gcttaccgga tacctgtccg cctttctccc ttcgggaagc gtggcgcttt

     4501 ctcatagctc acgctgtagg tatctcagtt cggtgtaggt cgttcgctcc aagctgggct

     4561 gtgtgcacga accccccgtt cagcccgacc gctgcgcctt atccggtaac tatcgtcttg

     4621 agtccaaccc ggtaagacac gacttatcgc cactggcagc agccactggt aacaggatta

     4681 gcagagcgag gtatgtaggc ggtgctacag agttcttgaa gtggtggcct aactacggct

     4741 acactagaag aacagtattt ggtatctgcg ctctgctgaa gccagttacc ttcggaaaaa

     4801 gagttggtag ctcttgatcc ggcaaacaaa ccaccgctgg tagcggtttt tttgtttgca

     4861 agcagcagat tacgcgcaga aaaaaaggat ctcaagaaga tcctttgatc ttttctacgg

     4921 ggtctgacgc tcagtggaac gaaaactcac gttaagggat tttggtcatg agattatcaa

     4981 aaaggatctt cacctagatc cttttaaatt aaaaatgaag ttttaaatca atctaaagta

     5041 tatatgagta aacttggtct gacagttacc aatgcttaat cagtgaggca cctatctcag

     5101 cgatctgtct atttcgttca tccatagttg cctgactccc cgtcgtgtag ataactacga

     5161 tacgggaggg cttaccatct ggccccagtg ctgcaatgat accgcgagac ccacgctcac

     5221 cggctccaga tttatcagca ataaaccagc cagccggaag ggccgagcgc agaagtggtc

     5281 ctgcaacttt atccgcctcc atccagtcta ttaattgttg ccgggaagct agagtaagta

     5341 gttcgccagt taatagtttg cgcaacgttg ttgccattgc tacaggcatc gtggtgtcac

     5401 gctcgtcgtt tggtatggct tcattcagct ccggttccca acgatcaagg cgagttacat

     5461 gatcccccat gttgtgcaaa aaagcggtta gctccttcgg tcctccgatc gttgtcagaa

     5521 gtaagttggc cgcagtgtta tcactcatgg ttatggcagc actgcataat tctcttactg

     5581 tcatgccatc cgtaagatgc ttttctgtga ctggtgagta ctcaaccaag tcattctgag

     5641 aatagtgtat gcggcgaccg agttgctctt gcccggcgtc aatacgggat aataccgcgc

     5701 cacatagcag aactttaaaa gtgctcatca ttggaaaacg ttcttcgggg cgaaaactct

     5761 caaggatctt accgctgttg agatccagtt cgatgtaacc cactcgtgca cccaactgat

     5821 cttcagcatc ttttactttc accagcgttt ctgggtgagc aaaaacagga aggcaaaatg

     5881 ccgcaaaaaa gggaataagg gcgacacgga aatgttgaat actcatactc ttcctttttc

     5941 aatattattg aagcatttat cagggttatt gtctcatgag cggatacata tttgaatgta

     6001 tttagaaaaa taaacaaata ggggttccgc gcacatttcc ccgaaaagtg ccacctgacg

     6061 tcgacggatc gggagatctc ccgatcccct atggt

//

 

Caution:
Product is for research use only!

No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart