pCL- Eco Plasmid

$216.00

  • Model: PVT2203
  • 50 Units in Stock
Ask a question


Add to Cart:

pCL-Eco

Search name

pCL-Eco,Plasmid pCL-Eco,pCL-Eco vector

 

pCL-Eco Information

Promoter: CMV

Replicator: pUC ori, SV40 ori

Terminator: SV40 poly (A) signal

Plasmid classification: virus series, retrovirus packaging vector map

Plasmid size: 12341bp

Plasmid label: gag-pol

Prokaryotic resistance: Amp

Cloned strain: Stbl3

Culture conditions: 37 centigrade, aerobic LB

Expression host: mammalian cells

Induction mode: no induction, instantaneous expression

5'sequencing primers: CMV-F:CGCAAATGGGCGGTAGGCGTG

3'sequencing primers: primers designed according to sequence

 

pCL-Eco Description

pCL-ECO packaging vector is a part of the RetroMax expression system and has been designed to maximize recombinant-retrovirus titers in a simple, efficient, and flexible experimental system. By introducing a retroviral vector into a cell expressing retroviral proteins, retroviral particles (virions) are shed into the culture medium at the rate of about 1 infectious particle/cell/day. Retrovirus tropism is determined at 3 levels. The first is simply a function of viral envelope protein, gp70. The envelope determines which cells the virus will enter. gp70 comes in three different flavors for gene therapy. Retroviruses obtained by cotransfection with pCL-Eco vector will infect mouse and rat cells, but not human cells.

 

pCL-Eco Sequence

LOCUS       Exported               12341 bp ds-DNA     circular SYN 06-SEP-2016
DEFINITION  synthetic circular DNA
ACCESSION   .
VERSION     .
KEYWORDS    Untitled 10
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 12341)
  AUTHORS   .
  TITLE     Direct Submission
  JOURNAL   Exported Tuesday, September 6, 2016 from SnapGene Viewer 3.1.4
             
FEATURES             Location/Qualifiers
     source          1..12341
                     /organism="synthetic DNA construct"
                     /mol_type="other DNA"
     rep_origin      283..871
                     /direction=RIGHT
                     /note="ori"
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     rep_origin      1107..1241
                     /note="SV40 ori"
                     /note="SV40 origin of replication"
     polyA_signal    1699..1833
                     /note="SV40 poly(A) signal"
                     /note="SV40 polyadenylation signal"
     CDS             complement(2105..2125)
                     /codon_start=1
                     /product="nuclear localization signal of SV40 large T 
                     antigen"
                     /note="SV40 NLS"
                     /translation="PKKKRKV"
     intron          2255..2320
                     /note="small t intron"
                     /note="simian virus 40 (SV40) small t antigen intron"
     misc_feature    5033..5407
                     /note="pol region"
                     /note="Moloney murine leukemia virus (MMLV) pol region 
                     containing the splice acceptor site"
     CDS             complement(9767..10183)
                     /note="gag (truncated)"
                     /note="truncated Moloney murine leukemia virus (MMLV) gag 
                     gene lacking the start codon"
     promoter        complement(10495..10698)
                     /note="CMV promoter"
                     /note="human cytomegalovirus (CMV) immediate early 
                     promoter"
     enhancer        10699..11078
                     /note="CMV enhancer"
                     /note="human cytomegalovirus immediate early enhancer"
     promoter        11488..11592
                     /gene="bla"
                     /note="AmpR promoter"
     CDS             11593..112
                     /codon_start=1
                     /gene="bla"
                     /product="beta-lactamase"
                     /note="AmpR"
                     /note="confers resistance to ampicillin, carbenicillin, and
                     related antibiotics"
                     /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI
                     ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVEYS
                     PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW
                     EPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA
                     LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS
                     LIKHW"
ORIGIN
        1 tggtaagccc tcccgtatcg tagttatcta cacgacgggg agtcaggcaa ctatggatga
       61 acgaaataga cagatcgctg agataggtgc ctcactgatt aagcattggt aactgtcaga
      121 ccaagtttac tcatatatac tttagattga tttaaaactt catttttaat ttaaaaggat
      181 ctaggtgaag atcctttttg ataatctcat gaccaaaatc ccttaacgtg agttttcgtt
      241 ccactgagcg tcagaccccg tagaaaagat caaaggatct tcttgagatc ctttttttct
      301 gcgcgtaatc tgctgcttgc aaacaaaaaa accaccgcta ccagcggtgg tttgtttgcc
      361 ggatcaagag ctaccaactc tttttccgaa ggtaactggc ttcagcagag cgcagatacc
      421 aaatactgtc cttctagtgt agccgtagtt aggccaccac ttcaagaact ctgtagcacc
      481 gcctacatac ctcgctctgc taatcctgtt accagtggct gctgccagtg gcgataagtc
      541 gtgtcttacc gggttggact caagacgata gttaccggat aaggcgcagc ggtcgggctg
      601 aacggggggt tcgtgcacac agcccagctt ggagcgaacg acctacaccg aactgagata
      661 cctacagcgt gagctatgag aaagcgccac gcttcccgaa gggagaaagg cggacaggta
      721 tccggtaagc ggcagggtcg gaacaggaga gcgcacgagg gagcttccag ggggaaacgc
      781 ctggtatctt tatagtcctg tcgggtttcg ccacctctga cttgagcgtc gatttttgtg
      841 atgctcgtca ggggggcgga gcctatggaa aaacgccagc aacgcggcct ttttacggtt
      901 cctggccttt tgctggcctt ttgctcacat gttctttcct gcgttatccc ctgattctgt
      961 ggataaccgt attaccgcct ttgagtgagc tgataccgct cgccgcagcc gaacgaccga
     1021 gcgcagcgag tcagtgagcg aggaagcgga agagcgccca atacgcaaac cgcctctccc
     1081 cgcgcgttgg ccgattcatt aatgcagcct ccaaaaaagc ctcctcacta cttctggaat
     1141 agctcagagg ccgaggcggc ctcggcctct gcataaataa aaaaaattag tcagccatgg
     1201 ggcggagaat gggcggaact gggcggagtt aggggcggga tgggcggagt aagacccgca
     1261 cccgttccca aactgcttat taaagggggt atggaggtgc tggaccttgt gacagggcca
     1321 gacagtgtga cagaaataga agcagtcctg ttttgacaag ttgcctctgg aagcctctac
     1381 aatgcctctc ttctttttct ccagagtaag cggaggccag gggcccccgg cctctgctta
     1441 atactaaaaa aaacagctgt tgtcatagta atgattgggt ggaaacattc taggcctggg
     1501 tggagaggct ttttgcttcc tcttgcaaaa ccacactgcc ctctggaggg cagttgccta
     1561 gcaactaatt aaaagaggat gtcgcacggc cagctgcggt cagttagtca cttcctgctt
     1621 aactgacttg acattttcta ttttaagagt cgggaggaaa attactgtgt tggaggccct
     1681 ccgccatctt ctgaagctga tccagacatg ataagataca ttgatgagtt tggacaaacc
     1741 acaactagaa tgcagtgaaa aaaatgcttt atttgtgaaa tttgtgatgc tattgcttta
     1801 tttgtaacca ttataagctg caataaacaa gttaacaaca acaattgcat tcattttatg
     1861 tttcaggttc agggggaggt gtgggaggtt ttttaaagca agtaaaacct ctacaaatgt
     1921 ggtatggctg attatgatct ctagtcaagg cactatacat caaatatttt tccataattt
     1981 tcttgtatag cagtgcagct ttttcctttg tggtgtaaat agcaaagcaa gcaagagttc
     2041 tattactaaa cacagcatga ctcaaaaaac ttagcaattc tgaaggaaag tccttggggt
     2101 cttctacctt tctcttcttt tttggaggag tagaatgttg agagtcagca gtagcctcat
     2161 catcactaga tggcatttct tctgagcaaa acaggttttc ctcattaaag gcattccacc
No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart